Conserved Protein Domain Family
DMAP1_like

?
pfam17024: DMAP1_like 
Putative DMAP1-like
This is a family of microsporidia-specific sequences that may have distant homology to the family DMAP1, pfam05499.
Statistics
?
PSSM-Id: 319087
View PSSM: pfam17024
Aligned: 10 rows
Threshold Bit Score: 128.996
Threshold Setting Gi: 523779552
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74622171   19 RKYLKVLNSIESIRKDRNDVLSIYFNEVC------------TYNIDDLEDRSAVVKRLINREFTYPNAFLASSLGFNKTT 86
gi 378755780  34 EWFVDLLKTHQMLKEARQVILDRHFGELG------------ISANLEEQEKLLLIHEYINKELVYPPVFLGSTLGFNKNN 101
gi 906373066  34 EWFVDLIKTHDKLMLARNVVLNRHFGELS------------VSANLEEQEKLLLIHEYINKELVYPPVFLGSSLGFNKNN 101
gi 484856643   7 KNFLNLLEKVEELSSKRKQILERHFYELT------------KYNIDDLEDRDSIITRIVGKAPSHPNAFLASSLGFTKSS 74
gi 667634323  14 ssYKRFLESLPSTLEHRKRILHTHFGEFL-------------VAIPTNEDFESKINAIIGKMHPHPYIYLASSIGFSKMT 80
gi 300706697  22 ESYAKLIRNIRELKSTRDSIINRHFYELY------------HYNIDELEDRDVRIKRLIGKSTSYPNSFLASSLGFNRTT 89
gi 484854504  37 KNFLNLLEEVEELSLKRKQILERHFYELT------------KYNIDDLEDRDSIITRIVGKAPSHPNAFLASSLGFTKSS 104
gi 402466383  15 QSFIDLVKKVEKVKKDRKEILERHFPELF------------ETKPEAKKDLEIRISEIINKNISHPPVFLASILGFSKSN 82
gi 269861055   8 KEFLKELKNIEIYKKNRQSILNMMFWEYE------------NYNTHLFEDKDTKIYKIIPEKRTYHNSFLGSSLGFNKST 75
gi 523779552  87 KELNKFIKNIENNYMKRLSIIRTYLGELFldsytkrsnvftSNTIDSIIDIRLNNYNIISNKQQLPSVYMGSNIKISKSM 166
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*
gi 74622171   87 WSRDYEKTLKEIGMDKRPKYSTLRNMLLFEKLKWLIIRYHEAKQK 131
gi 378755780 102 WNKNIERMLEPYGIRQKPVFCTKDTCYLFERMKYLMLKYMEKIRK 146
gi 906373066 102 WNKNIEKILEPYGIRQKPVFCAKDTCYLFERMKYLILKYMEKIRK 146
gi 484856643  75 WNKKYENMFLKFGLDRKLKHSTYRNMLHFEKLKLLVIKYHEVNKK 119
gi 667634323  81 WNRSVEKILNQFELKMKLKYPTLKNYSRYEKLKYLLIRYFDKRKE 125
gi 300706697  90 WVKKYEEILGKFDLGKKPKYLTMRNMMLFEKLKLLVIKYFNSKKK 134
gi 484854504 105 WNKKYENMFLKFGLDRKLKHLTYRNMLHFEKLKLLVIKYHEVNKK 149
gi 402466383  83 WNKTVEKMLIDLGLTSRLRYCSYENMQRYEKLKHLILKYIDKKYK 127
gi 269861055  76 LEPKYIDILHKFDLEKKPIVPSPKNCIEFEKLKYLIIKFFELNKK 120
gi 523779552 167 CTRSVENFLKKFHLDKQLKYPSVRNTKRMEQLKSLINKLMKKKDY 211
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap