Conserved Protein Domain Family
DUF5099

?
pfam17025: DUF5099 
Domain of unknown function (DUF5099)
This is a family of microsporidia-specific sequences of unknown function.
Statistics
?
PSSM-Id: 319088
View PSSM: pfam17025
Aligned: 9 rows
Threshold Bit Score: 104.03
Threshold Setting Gi: 300701942
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74621534   17 KIPKTTLIVDGYG-TITEEEKRKIQG--MKMN----------------------------------IDF--EERTTHYSL 57
gi 402466338  18 KLPKYVLVISRYS-EIKANLIKSLKLk-YKIEdvkilgdkd-----------------deytiknrINM--TKGGKYPDL 76
gi 672236962  34 KKAAWVLVINMYS-PVQSSVLDQLGDk-YGIKltvqendqdtfqnnhkkfcksigeytekvpyvdiMDFvsSNKSMFPDI 111
gi 906372354  34 KRPKWVFIINMYG-CVPKETIEKLGKt-HDIKltvqetdqdtfqsnhakfckmigesktkvpyneiVEFisKNKSVFPDI 111
gi 667634245  19 KKPDIIFIVDAYK-DVPPHDIGELQSk-YGIKkililkrdd----------------ldtfhaqepLDI-----QSLPDL 75
gi 440494250  19 KKPNLIFIINAYQ-NISLDEIQRLRDk-YGIEkivglqrdd----------------fdtfytqeqLD-----RNNLPDL 75
gi 484857543  64 KIPKNILIIDKINpEIDKDLKKKIISfsKDINiffcdci--------------------kdsflceICI--KNKEMKYDL 121
gi 523780084  14 KLPSYFLIVNNKA-KLSNTDIIRVKEltNGIVdrve--------------------------iineMDSn-EDLDGHPDL 65
gi 300701942   6 KTPKKILILNNIG-TLSQDLKIKIRkflp----------------------------------nslIDF--EENDIQYDL 48
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|
gi 74621534   58 VILCNTTLRFNLANPLTLAECEIWFTRKAFSSRVFMDALIHYSECEIKNG 107
gi 402466338  77 IILCSDVLMFYLQDPLILYKAEIWHERRDFCESTFVYALRHYDECEIRNG 126
gi 672236962 112 VILCSDKTIFKTTSPFLLYSAELLHTRKDFSEDALIRALQHYADCEIRNG 161
gi 906372354 112 VILCSDTTVFKTNSPFLLYSAEVLHFRKNFSSDVLESALNHYSLCEVRNG 161
gi 667634245  76 IIYCNNKLEFKLREPEILYKAEIVFSRFGFGERLFVEALDHYSSCVINSG 125
gi 440494250  76 IIYCNIKLEFKLRQPEILYKAEIVFSRFGFSEGLFVKALDHFSKCIINNG 125
gi 484857543 122 VFLCNYSLFFNLKSPLNICESEIIFNRKRIDFGIFMKGIEYYSECEIRNG 171
gi 523780084  66 ILLLNDVLYFHLKNPLLLYKAEIFIYKKNFCMDAVYKALSHYSECKINNG 115
gi 300701942  49 VFLLDYIFKFNLQYYKPISVAEIIFKRQTFDFKIFEEGLRHYSDCEIRNG 98
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap