Conserved Protein Domain Family
CBP_CCPA

?
pfam17040: CBP_CCPA 
Cellulose-complementing protein A
This is a family of bacterial cellulose-complementing protein A proteins necessary for cellulose biosynthesis. Cellulose is necessary for biofilm formation in bacteria. (Roemling U. and Galperin M.Y. "Bacterial cellulose biosynthesis. Diversity of operons and subunits" (manuscript in preparation)).
Statistics
?
PSSM-Id: 319101
View PSSM: pfam17040
Aligned: 2 rows
Threshold Bit Score: 457.011
Threshold Setting Gi: 489713840
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75425707   12 GGQAGSPQDFQRVLRSFGVEGGQYSYRPFVDRSFDVTGVPEAVERHFDQAEHDTAVEEQVTPAPQIAVAPPPPPVVPDPP 91
gi 489713840   4 GGQAGSPQDFQRVLRSFGVEGGQYSYRPFVDRSFDVTGVPEAVERHFDQAEHDTAVEEQVTPAPQIAVAPPPPPVVPDPP 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75425707   92 AIVTETAPPPPVVVSAPVTYEPPAAAVPAEPPVQEAPVQAAPVPPAPVPPIAEQAPPAAPDPASVPYANVAAAPVPPDPA 171
gi 489713840  84 AIVTETAPPPPVVVSAPVTYEPPAAAVPAEPPVQEAPVQAAPVPPAPVPPIAEQAPPAAPDPASVPYANVAAAPVPPDPA 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75425707  172 PVTPAPQARVTGPNTRMVEPFSRPQVRTVQEGATPSRVPSRSMNAFPRTSASSISERPVDRGVADEWSPVPKARLSPRER 251
gi 489713840 164 PVTPAPQARVTGPNTRMVEPFSRPQVRTVQEGATPSRVPSRSMNAFPRTSASSISERPVDRGVADEWSPVPKARLSPRER 243
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75425707  252 PRPGDLSFFFQGMRDTRDEKKFFPVASTRSVRSNVSRMTSMTKTDTNSSQASRPGSPVASPDGSPTMAEVFMTLGGRATE 331
gi 489713840 244 PRPGDLSFFFQGMRDTRDEKKFFPVASTRSVRSNVSRMTSMTKTDTNSSQASRPGSPVASPDGSPTMAEVFMTLGGRATE 323
                        330       340
                 ....*....|....*....|..
gi 75425707  332 LLSPRPSLREALLRRRENEEES 353
gi 489713840 324 LLSPRPSLREALLRRRENEEES 345
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap