Conserved Protein Domain Family
SafA

?
pfam17073: SafA 
Two-component-system connector protein
SafA is a bacterial transmembrane protein family that connects the signal transduction between the two component systems EvgS/EvgA and PhoQ/Phop. SafA interacts with PhoQ, leading to the PhoQ/PhoP system activation in response to acid stress conditions.
Statistics
?
PSSM-Id: 319116
View PSSM: pfam17073
Aligned: 2 rows
Threshold Bit Score: 77.3676
Threshold Setting Gi: 88909723
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60
               ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 81345794  1 MHATTVKNKITQRDNYKEIMSAIVVVLLLTLTLIAIFSAIDQLSISEMGRIARDLTHFIINSLQ 64
gi 88909723  1 MHATTVKNKITQRDNYKGIMSVIVVVLLLTLTLIAIFSAIDQLGISEMGRIARDLTHFIINSLQ 64
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap