Conserved Protein Domain Family
YCF90

?
pfam17088: YCF90 
Uncharacterized protein family
Ycf90 is an algal protein located in chloroplasts. Its function is unknown.
Statistics
?
PSSM-Id: 319117
View PSSM: pfam17088
Aligned: 2 rows
Threshold Bit Score: 709.824
Threshold Setting Gi: 700658189
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 700658189  10 LSSVLSLSINIDQETILDFLGIDGPFNSSDYSYLFENSNVSTPVSFETFKLIIQSIWRHYQHGLGFVDIENLALFILIIR 89
gi 118411156  10 LSSVLSLLINIDQETILDFLGINGPFNSEDYSYLFGTSQVSTPVSLETFKLIIQSIWEHYQHGLGFVDIENIALFILVIR 89
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 700658189  90 FIFLSKKYNIKTGFFITCIGLAAGYLWYMHLRDLAYYYMRTLWMCPLTHNLAYDFSEIYYQQKSQFSKAGARFDSRTFYG 169
gi 118411156  90 FIFLSKKYNIKTGFFITCIGLGAGYLWYMHLRDLAYYYMRTLWMCPLTHNLAYDFSEIFYQQRSEFSKAGTRFDSNSFYG 169
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 700658189 170 PIVRAFTSMTSTDTYRYDPISMLWSYLPTSIKFLSDKLYYFITLKAIPQTYRFIDTQITNLSGMLWYTFIVRINKRYCPY 249
gi 118411156 170 PAVRAFTDITSNDNYRYDPISMLWSYLPTDIKFLSDKVYYFITLKAIPQTYRFIDTQITNLSGMLWYTFIVRINKRYCPY 249
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 700658189 250 LLRWHWTFLIGIEFIERPFIFVQDRLIYYLNNILIPNSYFREAELITNLLITLVAAQYIFIILSMLHALCGQYFYFPFLT 329
gi 118411156 250 LLRWHWTFLIGLEFLERPFIFVQDRLIYYLNNILIPNSYFREAELVTNLLITLVAAQYIFIILGMLHALCGQYFYFPFLT 329
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 700658189 330 ENTELHIGLRPKDSIYSGGHTIWQNKRAYMISRQASAKLKKYRFGTIRATYAKLPRLWYGWLGRGTID 397
gi 118411156 330 ENTELHIGLRPKDSIYSGGHTIWQNKRAYMISRQASSKLKKYRFGTIRSAYSKLPRLWYGWLGRGTLD 397
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap