Conserved Protein Domain Family
NACHT_N

?
pfam17100: NACHT_N 
N-terminal domain of NWD NACHT-NTPase
This is an N-terminal domain on putative NWD NACHT proteins, signal transducing ATPases which undergo ligand-induced oligomerization.
Statistics
?
PSSM-Id: 319122
View PSSM: pfam17100
Aligned: 37 rows
Threshold Bit Score: 222.513
Threshold Setting Gi: 835894020
Created: 14-Apr-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121937797   122 ERLWNAAYDSLETD--NAELVVSYLKTLE--------TVLGANPGITPDT-----------DISAEFHDPTKRQIHMRRL 180
gi 927418068    60 vSLWDRAYDSLREK--EGQQVEEYEELLSr------eLQATTGSKNGEHF-----------YNKIEGTNHKIRLAQLETI 120
gi 472243016    84 KSLWDCAYDAVKKE--NPELVTKYEKLLS--------TELLEKDSEPDEDplkqakktldqTDNIIDSKLLNRRAQLKAI 153
gi 930145434   167 QPLWDRAYTALTKD--QETLVKEYEDLLS-------------REAQTTGA-----------ASENASNGGQLRRAQLAAV 220
gi 1027002027  113 DSLWDRAYEALKKD--KQQLVREYEKLL-----------AKEVQTANLAS-----------EAALQDSSRSLRQAQLTTV 168
gi 358368395    59 ESLWDQAYKNL-----DPGLVEEYEELLA--------KQRQEI-------------------NDNSCKNGTNRQQDLDII 106
gi 557727523    80 DSVWSRAYDSLKEK--DAALVKRYEEILS--------KEYFSPCSQEDMP-----------SNVIAQNDHRKRKLQMDDM 138
gi 835897936    51 EQLWTAAYAAFALA--NPELSGAFENIVN--------KETARTIPPGETV-----------TDNGAALEPSFRYQQMRRL 109
gi 835894020    76 lRLWDAAYQELKASsdTADLVAKYEGAL--------------QSELGEAA-----------TTRLLAGTSGERVLAMQDI 130
gi 512190647   154 QSLWNRAYDALAKQ--NPDLVKEYEKLLAkeeqmansASNDEPPAQPIPP-----------RDATCGPDSLSRETQLETV 220
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121937797   181 VEEGRAKLSRAS----------KITNGVGDVADFVLSVKGIIDLAVQSVPQAALPWAGVCVGLQMLRNPAQAMKSNLAGL 250
gi 927418068   121 TSSGLRKLDEKKarylifghefIPRDQLAKATQFIQNIKAVIDEAVRVSPEASLAWAGVSVILPIFMNPSVAEEVSRDGC 200
gi 472243016   154 ITCGQQRMDARKt---------GLQDTIAHGVEFLLWGKDLIGEAVKASPEASVAWAGVCIVLPLLTNASTADKANRDGF 224
gi 930145434   221 IEQGLRRMDENKlkytiashefNLTEQIDSAARFVLWAKNLVSEGAKASPEASVAWAGVCIILPLLTNPTTAAQANNDGF 300
gi 1027002027  169 IDGGLKRMDEKTtkytiaghdfVLKEQIAQASKFLLWAKDWVGEAVQASPQASIAWAAVCLVLPLLTNPTTAAEANQHGL 248
gi 358368395   107 INHGLHQAENQRt---------GVQEGLAQAASWVLSVKDFIGEAVKASPEASLAWAGVCIVLPLLTNPQSAAQANKSGF 177
gi 557727523   139 MRKGQQRIEKSRtkc-----rtLTWGGAASTANAVLATRDWVGQALKNSDEASLIWAGVSLIIQLVTNPITAHDSNMEGF 213
gi 835897936   110 ANVAMDKWKEKV----------QARDGFILAADVVQGLKDKIGAALEVSPPASLGFAGFCLILNGCTSGIEARRSCIEGL 179
gi 835894020   131 VKKAG-TSKHGA----------KAAEAAETTLKILNMIKGTVSELAQANPIAAFAWAGFCTVTPNLLAPIMENKTMRNGL 199
gi 512190647   221 IKQGLQRMEEAKatytiaghdfDLTDQITQAANLLLWAKDWIGAAVHASPEASIAWTGVCLILPLLTNPTTAAEANRDGF 300
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121937797   251 AHVISRMDWYCALTEHLLNKQNVATG---K---DIQAvlR---------Q-LERSIVELYKSLLQYQMKSVCSYY--HNQ 312
gi 927418068   201 LYVTSRILFYVKLESLLFSSNSIQDS--------GLN--V---------E-LEGSLIELYRQIIDFQIRTVRRVY--LTR 258
gi 472243016   225 AYVTTRMNYYVALEPLLLQVSHDSASvtvN---QNLV--L---------E-IKKHIIELYQHILDFQFRSVLRFY--RSH 287
gi 930145434   301 VYVTARLRYYTALEELVERLGRNEEV---S---KALF--E---------E-TTTHLVDLYQQILAFQLQSVLRFY--RGR 360
gi 1027002027  249 KTVTARMRYYVELEPVVHRLAANGRG---DvdmRGLM--E---------Q-VDSNIVDLYRQILEFQISSVLRFY--ANH 311
gi 358368395   178 TYVNGRIRYYVELERILWSTSSRSSD---H---TGLK--E---------Q-FNANIVKLYEEILHFEVKSVLRFH--RSW 237
gi 557727523   214 LYVTERLGFYNEF-----QTRWIPQV---P---DGLR--K---------S-FEKSVQDLYESILEFQLLSVIRFY--RSS 268
gi 835897936   180 TYVVERVEWYRTLTGLVLSEAAIDPA---N---QGQV--RalqpaaaqgL-LRGMLEGLFKALIEYQVKSVCAYYgrMNQ 250
gi 835894020   200 DHITGRMKWFMALSRVLLRESWSNDA---E---FQRF--R---------EvLDDKMVALYRKLLEFEVRCVCAWA---SP 259
gi 512190647   301 AYVTARMRYYVALEPLLRRLGENAGV---A---DMLM--S---------E-ANDHIVDLYQLILDFQLCSVLRFY--QGH 360
                          250       260       270
                   ....*....|....*....|....*....|.
gi 121937797   313 MLEFLRGMVNLDDWDVDLKLVTDAEATVQND 343
gi 927418068   259 LARYREDTLRHEDWKGMMARIQKSEETFRGD 289
gi 472243016   288 YKNFGRDSIQHENWSEMKTAITDLDKNVRKD 318
gi 930145434   361 IKAFAKDAILPKDWKQMRNDIKTREETINTD 391
gi 1027002027  312 LKTYAKDMVLPEDWTQMTLDIEARGETIRKD 342
gi 358368395   238 QRNSAGDIFRPKDWNGMVSSIKDLEKLVQQD 268
gi 557727523   269 IRNFGGDIFQPKRWDELLLRVKERESIVAQD 299
gi 835897936   251 ALTILKDLVNPNDWDAWLRDVKSAEEAFLRD 281
gi 835894020   260 FLAAAKDMVGWHGWDDLVTSIKTVESELNAD 290
gi 512190647   361 RKIYLHDMFSTKDWKQTTLDIKTREEIVNQD 391
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap