Conserved Protein Domain Family
Tom6

?
pfam17112: Tom6 
Mitochondrial import receptor subunit Tom6, fungal
Tom6 is the Tom6 subunit of the protein translocase complex TOM in fungi. This complex of the outer membrane of mitochondria is the entry gate for the vast majority of precursor proteins that are encoded by nuclear DNA, synthesized in the cytosol and imported into the mitochondria. Tom6 and Tom7 together play a role in the assembly, stability and dynamics of the TOM complex.
Statistics
?
PSSM-Id: 319134
View PSSM: pfam17112
Aligned: 17 rows
Threshold Bit Score: 62.4692
Threshold Setting Gi: 260950485
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....
gi 74602359    8 PKPESKLEQIKKTPAFTIALNATLFAAGVFFIQSPLMEMLVPQL 51
gi 74591645   58 KEEQSTFEKIKNSPAFTIGTQAALFGLGVLFIQSPLMDMLVPQL 101
gi 74694924   15 pKKQSMFQQFRDSPAYPVVVNLALFGVGVAFVQSSLMDMMAPQL 58
gi 444323928  25 KSKVSKIEEFKKTPLYTVLLNGGLFIAGVVLIQSPIMDMLAPQL 68
gi 598070795  11 PKEESTFQKIKSTPAFIVGTQAVLFGLGVLFIQSPLMDMLVPQL 54
gi 363753672  17 PKKQSRFQQFKESPAFPVLVNVTLFGLGVAFMQSSLMDMMAPQL 60
gi 255717288  14 AKKPSRFEQFKQTPAFPVLVNLGLFVAGVAFIQSPLMDMMAPQL 57
gi 354545492  12 tEEKSTFQKIRETPAFAVGTQVTLFGLGVLFIQSPLMEMLVPQL 55
gi 448521100  53 kEEKSTFQKIKETPAFAVGTQVALFGLGVLFIQSPLMDMLVPQL 96
gi 260950485   4 KQQPTTLEQITKTPAFAVAVQVGLFAAGVAFIQSPLMDFLVPQL 47
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap