Conserved Protein Domain Family
zf-C3HC4_5

?
pfam17121: zf-C3HC4_5 
Zinc finger, C3HC4 type (RING finger)
Statistics
?
PSSM-Id: 319141
View PSSM: pfam17121
Aligned: 7 rows
Threshold Bit Score: 110.217
Threshold Setting Gi: 27151622
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|.
gi 27151622    10 DEKCPLCQADRYLNPNMKLLINPECYHKMCESCVDRIFTTGPAQCPTPGCN 60
gi 350296940   12 DEMCPVCKSRKYLNPDIVFVFNPECYHSMCLNCANRLFNDGPNQCPHAGCN 62
gi 116180532   15 EDMCPVCKTIRYLNKDMEFLINPECYHSMCSNCVNRLFNDGPNQCPYAGCH 65
gi 629690121   26 DETCPVCKTTRYFNRDMEFLINPECYHRMCKTCVERIFKDGPNQCPYATCH 76
gi 242801232   14 DEVCPICKSSRYLNPDMRFLINPECYHKMCESCVDRIFSSGPNSCPVIGCK 64
gi 1030125165  21 DDICPVCKSSRYLNPSLRFLVNPACYHKMCESCVDRLFSHGPQPCPIPKCH 71
gi 1040551988  16 DDICPVCKSNRYLNPSLTFLINSECYHTMCTSCVDRLFTSGPAPCPVAGCH 66
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap