4Q6M


Conserved Protein Domain Family
Peptidase_M99_m

?
pfam17130: Peptidase_M99_m 
beta-barrel domain of carboxypeptidase M99
This is the central, beta-barrel, domain of the metallo-carboxypeptidase that maintains helical cell-shape in Helicobacter. It shows a novel fold. It has a highly positively charged surface which contributes to a high overall isoelectric point. A calcium-binding channel is formed from residues in the C-terminal Ig-like domain in conjunction with some of the long side-chains of residues from strands beta-14 and beta-18 of this domain.
Statistics
?
PSSM-Id: 319149
View PSSM: pfam17130
Aligned: 2 rows
Threshold Bit Score: 134.309
Threshold Setting Gi: 502787736
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
4Q6M_A       267 DKNLWAKISSLPKMPLFNLRPKLNHFPLPHNTkIPQIPIESNAYIVGLVKNKQEVFLKYGNKLMTRLSPFYIE 339
gi 502787736 229 DTHLDVRIAKSITLPLYGLREELNYFPLPKQS-ISSIPLESRAHILGLLQKDNQVLLKYGNKVMTKFSPEYLD 300
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap