Conserved Protein Domain Family
CHASE7

?
pfam17151: CHASE7 
Periplasmic sensor domain
CHASE7 is a conserved periplasmic sensor domain found in histidine kinases and diguanylate cyclases/phosphodiesterases, including the diguanylate cyclase DgcQ (YedQ) that regulates biofilm formation and motility in Escherichia coli (Hengge R. et al. (2015) [A systematic naming system for GGDEF- and EAL-containing c-di-GMP turnover proteins in Escherichia coli K-12]. J.Bacteriol., in preparation).
Statistics
?
PSSM-Id: 319169
View PSSM: pfam17151
Aligned: 8 rows
Threshold Bit Score: 246.169
Threshold Setting Gi: 657065791
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20140530   41 TWREVVVLEDAYISSQRNHLENVANALDKHLQYNVDKLIFLRNGMREALVAPLDFTSLRDA-VTEFEQHRDEHAWKIELN 119
gi 20140631   41 TWREVMILKDAYVASQRNHLGSVANVLDRQLQFNMDRLIFLRNGMHEALVAPLAFSALQSA-VTQFEQRRVRHFWQLELD 119
gi 571166229  17 IWREINVLEEAYVANQRNNLANVAHEMDGLLQFNIDRMMFFRHGMQAALEQPLDIDVLRKA-SQRYLSQRHQQAWRVALP 95
gi 657065791  47 iFRGMMLSRDAEIESVRQMQAVRAVSINALLQLEAERLTNIRNYAEHLMQIQDELPALFAHdIQTAFEHRNDDVWALR-- 124
gi 157082457   8 TWREVVVLESAYRASQRNHLENVANVLDRQLQFSVDKLLFLRNGMYEALVTPLDFADLHDA-VAQFAQLRGKSFWQLELD 86
gi 504541477  34 TWREGVILQDAFISSQRNQLDSIATAMDRNLQYSVDKLLFYRAGMRYAMHNLLEGPQTDAL-IAGFKAERDKPEWTLPTG 112
gi 503274904  32 TVHEALELKTSYEDRQRAQLAEIQKNLDSQFQESVDELVYYQKMLSYALMHPLDSDNAREA-VQRFQTLRQRPLWQLQLN 110
gi 488370704  35 AWRVAVVLEQAYVAEQVSSLEEVASALDRQFQHSVDNLLFYRNTMHYALQSPSSTDKTRLA-IEQFAERRSAPDWSVRLA 113
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20140530  120 RRRTLPVNGVSDALVSEGNLLSRENESLDNEITAALEVGYLLRLAHNSSSMVE-QAMYVSRAGFYVSTQPTLFTRNVPTR 198
gi 20140631  120 KRRTLPLYGVSDQFVARTTLLSRESRDLANELTATLELGYLARLARSSAMLAL-ETMYVSRSGFYLSTLPTAYGSDIVSR 198
gi 571166229  96 NRRTLPVFGISGSVAGDNPILLVDDPLAADELMATLELGYLLNLTQHDRDFAE-RMQYISRSGFFTSTLPLRDESQVITH 174
gi 657065791 125 TRDAAPVFGVSAAQLTGLDGFLRDDAKLIPSMAVAIALSHMFSAGHNEPGLRE-RIAYVSGNGIIV-AYPAISEQDVNPT 202
gi 157082457  87 RRRTLPLNGVSDAFVNRTTLLSRDNDALANELSAALELGYLLRLAHSSTMLAQ-RTMYVSRSGFYVSTEPTTNGGDIMSR 165
gi 504541477 113 RDLAPEIQGVSDTFIGQSTLLERDDALLYSELNATLALGHMLSIADARAERPEvRTFYVSRAGFYLTNLPFYGHGSIPEL 192
gi 503274904 111 SPRSMPLNGVGDAWLARDPLLKRDSALIDQEIRAALEFSFIMQFSDPDHDFHS-RFWYISRAGFYISSRPPQSPQELEQS 189
gi 488370704 114 QRRGLPVYGTSDDFVTRHPPLSRDIPELNNELTAALELSYILQLADYSQDFQR-RIFYVSRAGYYLATTPVPSGNRSEYL 192
                        170       180
                 ....*....|....*....|....*....
gi 20140530  199 YYGYVTQPWFIGHSQRENRHRAVRWFTSQ 227
gi 20140631  199 YYQYVTQPWFIEQSQRRNSQRGVRWFTSA 227
gi 571166229 175 YSQALGAPWFTRQTQRNNPGRGVIWQTFP 203
gi 657065791 203 LRSLASAAYFRNNLPLANPTRKQQWSIAR 231
gi 157082457 166 YYQYVIQPWFSGQSQRQNSARGVRWFSSP 194
gi 504541477 193 YYQQVSSRWFLDQSRRRNPGRGVRWLHGR 221
gi 503274904 190 YATMVQRAYFRALDPQQNISPQLRWTSGY 218
gi 488370704 193 FGKILNAPWFEGNKEHINRARAVVWTDSV 221
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap