Conserved Protein Domain Family
GAPES1

?
pfam17155: GAPES1 
Gammaproteobacterial periplasmic sensor domain
GAPES1 (GAmmaproteobacterial PEriplasmic Sensor) domain is a periplasmic sensor domain found in diguanylate cyclases and methyl-accepting chemotaxis proteins, including the diguanylate cyclase DgcJ (YeaJ) that regulates biofilm formation and motility in Escherichia coli and (Hengge R. et al. ((2015)) 'A systematic naming system for GGDEF- and EAL-containing c-di-GMP turnover proteins in Escherichia coli K-12'. J.Bacteriol., in preparation).
Statistics
?
PSSM-Id: 319173
View PSSM: pfam17155
Aligned: 4 rows
Threshold Bit Score: 444.295
Threshold Setting Gi: 386923202
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81523090   31 SDRAMNAYMRYIMERADSSFLYDKYQNQSIAAHLMRTFEAPGDPVTAEKHRAFCDAFEAINGTHGVNLTRHNYPALHGTL 110
gi 9911124    31 SDRAMSAYLRYIVQKADSSFLYDKYQNQSIAAHVMRALAAEQSEVSPEQRRAICEAFESANNTHGLNLTAHKYPGLRGTL 110
gi 488371946  32 ELDNLNKYTRYIAENGKSALFHEEYINQKISLHLSHSFSGKDTSTLTPAR--ICQKQERNGDIYGLNLNDHAFQPLPGTL 109
gi 501082098  31 SDRAMNAYMGYIIEKADSSFLYDKYQNQSIAAHLMRTFTEPKTPPSDEQQYALCRGFETGRNTHGINLTTHNNPSLHGTL 110
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81523090  111 QTAATQCTDNLDDALLLPAFDQAVSINRSQDDHSHGLGTLELKFRYYVDLNKHYVYFYDLINSRRFAMHRWTFLQKG--- 187
gi 9911124   111 QTASTDCDTIVEAAALLPAFDQAVEGNRHQDDYGSGLGMAEEKFHYYLDLNDRYVYFYEPVNVEYFAMNNWSFLQSG--- 187
gi 488371946 110 QTKNPNCNDWAGDVPDLLFFNKKIGSISSKYSFSNYTGYLFNNTRYYIDLKKNYIYINKIFDYRKYIFSNWLIKKRNnid 189
gi 501082098 111 QTAEANCAIVADDAPLLFAFDQAVAANRNQKDYGKGLGTVEDKFHYYLDIKKRYVYFYNLIDSRQFFMHHWSFLRKG--- 187
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81523090  188 ------TMGINRKDIDKLFTGRTVISSIYMDDITQENVMSFLTPVYLAGSLKGIVMVDVNQDNLKNIFYTQDRPLVWRYL 261
gi 9911124   188 ------SIGIDRKDIEKVFTGRTVLSSIYQDQRTKQNVMSLLTPVYVAGQLKGIVLLDINKNNLRNIFYTHDRPLLWRFL 261
gi 488371946 190 irtsvhTIDIDENALDDLENGESIVSHIYNDGDTQGNIISLLMPVFSSGDIKGIIITDINISDLTTAFYTHDRPFLWKFI 269
gi 501082098 188 ------TLGINRNDIDGQFTGRTVLSSIYQDDLTEKNVMSFLTPVYLHGKLKGIVMVDINQDNLKNIFYTQDRPLVWRYL 261
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|...
gi 81523090  262 NVTLKDMDSGKEIIINQSKNNLFQYVNYSHDIPGGLRVSLSLD 304
gi 9911124   262 NVTLTDTDSGRDIIINQSEDNLFQYVSYVHDLPGGIRVSLSID 304
gi 488371946 270 TLYVKDNHAGKIIDFHQPSLKIFDVSHYQTSITKYYTLHIGID 312
gi 501082098 262 DATLFDLNSEKKIIVHQSENNLFNYVNYVHDLPGGIRVTLSLD 304
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap