Conserved Protein Domain Family
DUF5126

?
pfam17166: DUF5126 
Domain of unknown function (DUF5126)
This domain lies C-terminal to DUF4959, pfam16323.
Statistics
?
PSSM-Id: 319184
View PSSM: pfam17166
Aligned: 30 rows
Threshold Bit Score: 115.401
Threshold Setting Gi: 524576162
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81443811  128 LKPSVLTTFESLEv----nATFGGVYVNFKNPEKASLSIHVVTTD-S-LNQp-----YEAHVQYTQ-AEKGPFYVRGFKA 195
gi 81444339  124 LTPAVVQTQESLKv----tESFGGFFLDFNNAARSALSFYIYKWV-D-EHNe-----YEIHDVYSSqQEEGRLTIKGLEH 192
gi 81442986  130 LTPPVEFIYNSLKv----eNSFGGVSLTWENPTRENIILEVFKKD-D-GEw------ISLENFYSS-VLNGVAKIRNLAA 196
gi 502458103 126 DTPPYLLSRPTVTm----rQDFGGVQIDAINMAKANLGIIVIAPD-Q-TNKy-----QIIAQNYTD-KDTISFSLHGYDT 193
gi 495785550 129 LTPVYLMVKPTALl----sADFGGVNISALNPLKKPIGLILIAIDpS-TKGy-----EIVDQHYTN-QDTSNYSIRGYNT 197
gi 502449371 131 DTPYYALIRKSLKi----gSDYGGINIQAANTAKNAIAINTLTID-PvTGNf-----AIANENYTN-LAAINYSLRGYKP 199
gi 294981426 124 LEPAVKTIASSLNv----eEDFGGIKFKWENPGRAEVSIVVQQKD-S-LLDe----yVPLDTYYTS-SKEGVFAIYELDT 192
gi 502417423 119 LESLISIARNSLNm----vPGFGGIVADWSNPKKTEFGVRLMVKD-E-KGAl-----VTKEMYFSS-SEKERRSFRGFNP 186
gi 495861990 129 gKPTYQVLAESFKsdsnffSTFGGINLLYKNDNAANIILRLYKYE-L-DTAknqwawNTVNETYTK-AREGIIRVRGEKP 205
gi 524203986 130 LTPPVEYIYESLKi----tDSFGGVSLTWKNPTRQNIILEVTKKE-N-GEw------VSLENFYSS-IVEGQAKIRGLAA 196
                         90       100       110
                 ....*....|....*....|....*....|....*
gi 81443811  196 EERMFDIYVVDRWGNSSDTLYNVLTPYEETRLNKK 230
gi 81444339  193 KLLKLAIFVRDKWENTSDTLYAEITPWKESLLDKT 227
gi 81442986  197 EPITLGYRIQDRWENYSQMLEKESTPLYEEELSKS 231
gi 502458103 194 IPQKFGVYVTDQWGNISDTLLSTITPVYEAQMDKS 228
gi 495785550 198 TPRKFGVYVTDQFGNVSDTTFATITPIFETMLDKG 232
gi 502449371 200 EPTKFGVYISDRYGNISDTMVVTITPGYEEILNKr 234
gi 294981426 193 LPKNIEVFVQDRWENRSEIAKHTIVPLFDTEFEKN 227
gi 502417423 187 KETTFAIAFEDKWGNISDTTLLKTTPFFETVVPKP 221
gi 495861990 206 VATRYGIVVRDQWKNTSDTIVRTLTPLEELEFkni 240
gi 524203986 197 EPITLGYRIRDRWDNYSETLELESNPLYEEELDKS 231
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap