1V7V


Conserved Protein Domain Family
Glyco_hydro_36

?
pfam17167: Glyco_hydro_36 
Click on image for an interactive view with Cn3D
Glycosyl hydrolase 36 superfamily, catalytic domain
This is the catalytic region of the superfamily of enzymes referred to as GH36. UniProtKB:Q76IQ9 is a chitobiose phosphorylase that catalyzes the reversible phosphorolysis of chitobiose into alpha-GlcNAc-1-phosphate and GlcNAc with inversion of the anomeric configuration. The full-length enzyme comprises a beta sandwich domain and an (alpha/alpha)(6) barrel domain. The alpha-helical barrel component of the domain, this family, is the catalytic region.
Statistics
?
PSSM-Id: 319185
View PSSM: pfam17167
Aligned: 7 rows
Threshold Bit Score: 653.029
Threshold Setting Gi: 81531046
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1V7V_A        296 HWDERCAKFQVKSPNQGLDTMINAWTLYQAETCVVWSRFASFIEVGGRTGLGYRDTAQDAISVPHANPEMTRKRIVDLLR 375
gi 81625490   308 YWDDLLGRIQVETHDEKLNRMVNIWNQYQCMVTFNISRSASYFESGISRGIGFRDSNQDILGFVHMIPEKARQRILDLAS 387
gi 81531046  2371 YWKSILNTVVVNTPDESMNIIMNGWLMYQLISCRLWSRTA-FYQSGGA--YGFRDQLQDTMPLTFVRPDMTRKQILISAS 2447
gi 81623211   296 HWDERCAKFQVKSPNQGLDTMINAWTLYQAETCVVWSRFASFIEVGGRTGLGYRDTAQDAISVPHTNPAMTRKRLVDLLR 375
gi 75353424   296 HWNERCEKFQVSSPNEGLDTMINTWTLYQAETCVVWSRFASFIEVGGRTGLGYRDTAQDAISVPHANPAMTRKRIVDLLR 375
gi 501578686  313 YWHSRIENFKVKTPDESFDSMIGIWNAYQCFITFFWSRAASMIYVGHRDGYGYRDTVQDIQGIIHLDPQSAKDRLRLMLA 392
gi 501578687  307 YWNDILSKYQVNHNDEILSRMVNIWNQYQCMITFNLARSASYFESGISRGIGFRDSNQDILGAVHMIPERVRERILDLAS 386
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1V7V_A        376 GQVKAGYGLHLFDPDwfdpekedvapsksptvvpTPS-DEDKIHGikdTCSDDHLWLIPTICKYVMETGETSFFDQMIPY 454
gi 81625490   388 IQFEDGSTYHQFQPL-------------------TKK-GNNEIGG---GFNDDPLWLILSTSAYIKETGDWSILGEEVPF 444
gi 81531046  2448 RQFVEGDVQHWWHPVvdsgirtr----fsddllwLPYvTIDYIKGtgdLSILDE--VVPYIEDEPLKEGEDERYS-LTKV 2520
gi 81623211   376 GQVKAGYGLHLFDPDwfdpekadvkpsksptvvpTPS-DEDKIHGikdTCSDDHLWIVPTILNYVKETGDFAFIDEVIPY 454
gi 75353424   376 GQVKAGYGLHLFDPDwfdpekadvkpsksptvvpTPS-DDDKIHGiedTCSDDHLWIVPTIIKYVMETGEHSFFDEVIPY 454
gi 501578686  393 GQTSKGVALPLV--Ffdyeikp-----nqglsldNPY-YV-KRTGyteYRCDDHLWLYITTRQYVRETGDLAFLDEVIPY 463
gi 501578687  387 TMFEDGSCYHQYQPL-------------------TKR-GNNEIg---sGFNDDPLWIILSTGAYIKETGDFSILREVIPY 443
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1V7V_A        455 AD--G--GEASVYEHMKAALDFSAEYVGQTGICKGLRADWNDCLNL-------------------G-------------- 497
gi 81625490   445 DNdpN--KKASLFEHLKRSFYFTVNNLGPHGLPLIGRADWNDCLNL-------------------Ncfsknpdesfqttv 503
gi 81531046  2521 SD-----KTGTIYEHCIKAIDKALKF-GIHNIPLMGSGDWNDGMNTvg---------------nkG-------------- 2565
gi 81623211   455 AD--G--GNATVYEHMMAALDFSAEYVGQTGICKGLRADWNDCLNL-------------------G-------------- 497
gi 75353424   455 AD--G--GDATVYEHMKAALDFSAEYVGQTGICKGLRADWNDCLNL-------------------G-------------- 497
gi 501578686  464 SD--Y--GEDTVYEHLRKGILFSLSKLGKHGLTYGLDADWNDTLRL-------------------G-------------- 506
gi 501578687  444 NN--DetKKGTLFEHIKRAYHHVTDNLGPHGLPLIGRADWNDCLNLncfsknpdesfqttsnvegG-------------- 507
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1V7V_A        498 ----G--GESSMVSFLHFWALQEFIDLAKFLGKDQDVNTYTEMAANVREACETHLWDdeGGWYIRGLTKNGDKIGTAQQQ 571
gi 81625490   504 naldGrvAESVFIAGLFVLAGKEFVEICKRRGLEEEAREAEKHVNKMIETTLKYGWD--GEWFLRAYDAFGRKVGSKECE 581
gi 81531046  2566 ----K--GESVWLGWFLYSILQNFKDIAKLKNDDYRSGRYLELSDFIRESIDKNAWD--GNWYRRAYFDDGTPLGSAQND 2637
gi 81623211   498 ----G--GESSMVSFLHFWALESFLELSRYRNDEAATDKYQAMADGVREACETHLWDeqGEWYIRGLTKNGDKIGTFEQV 571
gi 75353424   498 ----G--GESSMVSFLHFWALQEFLDLAKFRNNDADVTKYTEMAANVREACETHLWDdeGGWYIRGLTKDGDKIGTAQQT 571
gi 501578686  507 ----Ee-GETVFASFQLYLALKIFAEFAEKKGKKEDLEWAEKEASKLYENLQRYAWE--GDRFVRGFM-GDEVIGSKNNS 578
gi 501578687  508 ----T--AESVFIAGLFVYATPDYIRMCEEMGEKEEAEWAKKAAQDMINAINNYGWD--GEWFLRAYDYFGRKVGSKECE 579
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1V7V_A        572 EGRVHLESNTLAVLSGLASQ-E-RGEQAMDAVDEHLFSP-YGLH-LNAPSFSTPNDDIGFVTRVYQGVKENGAIFSHPNP 647
gi 81625490   582 EGKIFIEPQGMCVMAGIGVDnG-YAEKALDSVKKYLDTP-YGLV-LQQPAYSRYYIELGEISSYPPGYKENAGIFCHNNP 658
gi 81531046  2638 ECQIDSLSQSWALISGGGKT-D-RAKVAMQSIEKYLVKEdRGMIlLLTPPFDDSKLNPGYIKGYVPGVRENGGQYTHAAT 2715
gi 81623211   572 EGKVHLESNSLAVLSGTVSH-E-RGIKAMDAVYKYLFSK-YGLH-LNAPSFATPNDDIGFVTRVYQGVKENGAIFSHPNP 647
gi 75353424   572 EGRVHLESNTLAVLSGAVSQ-E-RGEKAMDAVDENLFSE-YGLH-LNSPSFATPNDDIGFVTRVYQGVKENGAIFSHPNP 647
gi 501578686  579 EASFWLNPQVWSVLSGVATS-E-QAKIVMDNVEKILNTD-YGAM-IMYPPVRTLGLPVFRMILFNPGMKENAGIFCHPQG 654
gi 501578687  580 EGKIFIEPQGICTMAGIGKD-DgRAKLALDSCIKYLDTK-YGMV-LQQPAYSKYYLELGEISSYPPGYKENAGIFCHNNP 656
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1V7V_A        648 WAWVAETKLGRGDRAMKFYDALNPYNQNDII---EKRIAEPYSYVQFIMGRDHQDHGRANHPWLTGTSGWAYFAVTNYIL 724
gi 81625490   659 WVAIAETVIGRGDRAFEIYRKITPAYLEDIS---EIHRTEPYVYAQMVAGKDAPRHGEAKNSWLTGTAAWSFVAITQHIL 735
gi 81531046  2716 WVILAMTKLGEGKKAWKLFNMINPINHSRSFydcQTYKVEPYVMAADVYAKEP-HVGRGGWTWYTGTAGWMYRVGLEGIL 2794
gi 81623211   648 WAWVAEAKLGRGDRAMELYDALNPYNQNDII---ETRIAEPYSYVQFIMGRDHQDHGRANHPWLTGTSGWAYHATTNYIL 724
gi 75353424   648 WAWVAEAKLGRGDRAMKFYDALNPYNQNDII---EKRIAEPYSYVQFIMGKDHQDHGRANHPWLTGTSGWAYFAVTNFIL 724
gi 501578686  655 WLIKAETMLGNGNRAYKYFQEINPANMNDKA---EIREAEPYVHCQFVEGKDSPFHGRAHVHWLTGTASSVMVACVEGIL 731
gi 501578687  657 WVGIGETMIGRGWRAFDVYRKITPAYFEDES---EIHKMEPYVYCQMVAGKDAKRHGEGKNSWLTGTASWAFVLISQYIL 733

                  ...
1V7V_A        725 GVQ 727
gi 81625490   736 GIR 738
gi 81531046  2795 GLK 2797
gi 81623211   725 GIK 727
gi 75353424   725 GVR 727
gi 501578686  732 GLQ 734
gi 501578687  734 GVR 736
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap