Conserved Protein Domain Family
DUF5132

?
pfam17195: DUF5132 
Protein of unknown function (DUF5132)
Proteins in this family are uncharacterized, but have been identified as members of a gene cluster for the synthesis of Ansamitocin.
Statistics
?
PSSM-Id: 319213
View PSSM: pfam17195
Aligned: 7 rows
Threshold Bit Score: 40.9057
Threshold Setting Gi: 258591869
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*.
gi 122306466  30 LRPLVENALKNGIAIGVELRKQATRFVEDLEDLIAEVMAEQAAEKA 75
gi 559008094  22 VKPLVRGTVKTSMSLVMELKKAAHEAGEELHDMTAEVAAELIGAEL 67
gi 255921982  23 VKPLVRGVLKTSIGVAIEARRAAQVIGEELQDIAAEVSAEMTAAQI 68
gi 501375769  38 GKPLVKSVIKGGIGLYERSKGTIAEMGETWEDMVAEARAE-LADEK 82
gi 258591869  37 VKPLLKATIKGGILLYEKGQEAVAEAGEVIEDLAAEAKAE-LAQAP 81
gi 506282198  21 AKPLARGVVRTSAGIVAGARRAAHAVGEELQDITAEVTAELAAARL 66
gi 506265370  34 LKPLAKATVKTGVILYEKSKTTLAEVGEVLGDIVAEAKTEIIAEQA 79
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap