Conserved Protein Domain Family
AveC_like

?
pfam17198: AveC_like 
Spirocyclase AveC-like
AveC catalyzes the stereospecific spiroketalization of a dihydroxy-ketone polyketide intermediate in the biosynthetic pathway of Avermectin, a potent antiparasitic agent. Additionally, it has a unique dehydration activity that serves to determine the regiospecific saturation pattern for spiroketal diversity. MeiC, the counterpart in the biosynthesis of AVE-like meilingmycin, also has spirocyclase activity, but lacks the dehydratase activity.
Statistics
?
PSSM-Id: 319216
View PSSM: pfam17198
Aligned: 18 rows
Threshold Bit Score: 227.237
Threshold Setting Gi: 503939333
Created: 9-Apr-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 500106999   96 REGELPPVAIVAMawMLTAWQDPLVNALRPVFSYNSHFLN-FGSWGEFIPGWID---NGG--VNPQPIFWwiGIYlFFVP 169
gi 500181939  104 RRITLDGMLFVSC--GLLWFQDPLLNYFNTWSTYNTWMWN-MGSWVQDIPGWVSygePGA--MMAEPVLMnaPGY-FFVL 177
gi 499291120  116 verrllfdallflgllfASWQSPLMNWFHSVLVSNASVWGaVGSWGPYVPGWQGa-gPGA--EAEMPLAS--ASVcMSAL 190
gi 503939333  101 rrLTFDALLFIGL--LSASWQSPLMNWINPVLASNVNVFGaVASWGPYVPGWQG---AGAhqEAELPLAT--LSIcMTAM 173
gi 503596408  100 RRITLDGMLFLSI--GLMFFQDPLLNYFNTWCTYNTWLFN-RGAWTSHIPGWASpeePGR--QVAEPLLTnlPGYaYGVL 174
gi 503978250  106 RRITLDGILFVSC--ALFFFQDPLLNYFNTWCTYNTWLWN-RGSWSSHIPGWVSpesPGR--QVAEPLLInaTGYgM-VV 179
gi 500051632  105 RRITLDGMIMVST--GLFFFQDPLLNYINTWCTYNAWAFN-MGSWAPHVPGWMSpekPGA--QVAEPLGInvSGYaYGVL 179
gi 1039600182 104 RRITLDGMLFVSC--GLLWFQDPLLNYFNTWSTYNTWMWN-MGSWVQDIPGWVSygePGA--MMAEPVLMnaPGYfF-VL 177
gi 503593970   33 RRHHLHPLLLLSIsaISFSWIEAPYDW-AVYAQFPPALPR-MPSWWPLNMTW-----GGL--PLAVP-----IGYiSYFV 98
gi 499879213   33 RRGRLHPLLLVSIsaISFSWIEAPYDW-AVYAQFPPALPR-MPSWWPLNMTW-G---GGL--PSAVP-----IGYiAYFV 99
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 500106999  170 LNMMGVDAYLNWVRRHLPRINRAGLIGFLMILMFAQDVIGEWITLIQ-GVDRYLWVGGSISLWPGTDYQFPLYEGIFWGC 248
gi 500181939  178 LCTMLGCWVMRLAKKRFPNINTFGLIGVVIAWTFFFDFVIEGLFLMPmGLFTYPGAIQALSVNAGTYYQWPLYEGLMWGG 257
gi 499291120  191 IVTVLCSKALGWIKARRPAWRTWRLVLAVFFIGIVLG-LSEPLPSAS-GISVWARALPEVTLWSGEWYQFPVYQAVGSGL 268
gi 503939333  174 MAAVACGKGMGLAAARWPRLGPVRLIALGFLLVVLLD-IAEPLVSFA-GVSVWTRAVPELTIWSGHWYQFPLYQMVASAL 251
gi 503596408  175 LITIVGCAVMRKIKARWPGISNLRLIAVTYAISFVFDFVMEGLVLLPiGLYTYPGAIRSVSINADTYYQWPVYEGLMWGA 254
gi 503978250  180 VLAIVGCWFMRKIKARWPGISNVRLIMVTYAAAIVADFIMEACFLLPfGLYTYPGAIRSVSIFAGTYHQWPIYEGLMWGG 259
gi 500051632  180 LCTILGCWIMRKAQQRWPNLGTKGLIGVAFAWGFVFDFVMEGLVLMPlGMYTFPGAIQSLSINAGTYYQWPIYEGLMWGG 259
gi 1039600182 178 LCTMLGCWVMRLAKKRFPNINTFGLIGVVIAWTFFFDFVIEGLFLMPmGLFTYPGAIQALSVNAGTYYQWPLYEGLMWGG 257
gi 503593970   99 LPALIGAWLGRRVSARFGWRRPHTLLTVGLAVGFCWAFMFNAILGARlGNFSYGYVIPGLALWEGTPQQYPLYDSLAMGV 178
gi 499879213  100 LPAVIGAALGRRIVARFGWRRPQTLLAAGLLVGFLWALLFNGFFGPRlGVFYYGYVIPGLAIFEGGKYQYPIYDAIAMGI 179
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 500106999  249 GMVGLSAMIYyFRDARGHMFTDRGLARLKIRRGR-TLIRVLALGAVFNAAMIVFnlgYVAVNQHADTTQPTVPSYFQN 325
gi 500181939  258 VQAGLCCLRY-FTDDRGRTFVERGLDQVRGGFVKqQLTRFLAIFAACSAFFFVF---YNIPAQFFAMHQDPWPEDILK 331
gi 499291120  269 VCCMLGSLRF-FRDERDESWVERGAWRLPQRAA--NWARFLAVVGGVNAVMFLYtcfHILLSLVGGQPPDQLPDSFQA 343
gi 503939333  252 FGASLGAARH-FRNRRGETCLESGAALLPEGPR--PWVRLLAVVGGANISIALYtgaHILFSLMDGAPPDRLPEFFRP 326
gi 503596408  255 VQAALCCLRY-FTDDRGRTVVERGLDGVRGGFARqQFTRFLAIFAGVSACFFAF---YMGPAQWIALHADPWPQDHQK 328
gi 503978250  260 VMTALSCLRF-FTDDKGRTVVERGLDQIKGGFAKqQIIRCLAIFAAVSACFFFF---YNVPAQWFGMHADPWPEDHQK 333
gi 500051632  260 VQAALCCLRF-FTDDRGRTVVEKGLDNVRGGFAKqQLVRFLAIFAAISASFFTF---YIVPAQFMSTHADPWPEDVQK 333
gi 1039600182 258 VQAGLCCLRY-FTDDRGRTFVERGLDQVRGGFVKqQLTRFLAIFAACSAFFFVF---YNIPAQFFAMHQDPWPEDILK 331
gi 503593970  179 QMMVFTYLLG-RTDEQGRNVIEMWADKRSTSRLQsSVLSIVAVVVIGNALYGAVfapHLVTKLGGWVNSGPTEQLFPG 255
gi 499879213  180 QVMVFAYLLG-RTDGQGRNVIESWSDRVSKTRWQsAVVSIVAVVVVGHTVYGAVfapHLVTKLRGDVTSGPTEQLFPG 256
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap