Conserved Protein Domain Family
SeqA_N

?
pfam17206: SeqA_N 
SeqA protein N-terminal domain
The binding of SeqA protein to hemimethylated GATC sequences is important in the negative modulation of chromosomal initiation at oriC, and in the formation of SeqA foci necessary for Escherichia coli chromosome segregation. SeqA tetramers are able to aggregate or multimerize in a reversible, concentration-dependent manner. Apart from its function in the control of DNA replication, SeqA may also be a specific transcription factor. This short domain mediates dimerization.
Statistics
?
PSSM-Id: 319224
View PSSM: pfam17206
Aligned: 10 rows
Threshold Bit Score: 66.6737
Threshold Setting Gi: 357580482
Created: 19-Apr-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30
                  ....*....|....*....|....*....|....*.
gi 123588160    1 MKQIDIDDELYQYIASNTQSIGESASTILRRLLNLS 36
gi 357580482    1 MKNIEIEDDLYKYILANIEAFGETPSQILRRLLSLP 36
gi 357580523    1 MKIIEVDEELYQYIASQTKSIGESASDILRRLLNLP 36
gi 357580486    1 MKTIEVDEDLYRFIAGQTERIGESASDILRRLLLVD 36
gi 122299808    1 MKYIEIDEELYRFIASKTERIGESASDILRRLLNLS 36
gi 357580481    1 MKKIEIDDELYRYIASETRHIGESASDILRRLLKLD 36
gi 357580480    1 MKLIEVDEELYRYIAAHTQYIGESASEILRRMFSLT 36
gi 1102613402   1 MKTIEVDEDLYRYIAGHTQHIGESASDILRRMLKFT 36
gi 1119995662   1 MKTIDVDEELYSYIASHTQHIGESASEILRRMLNLG 36
gi 469489053    3 MKTIEVDDELYHYIASRTQVIGESSSDILRRLLRLP 38
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap