Conserved Protein Domain Family
SF_P

?
smart00019: SF_P 
Pulmonary surfactant proteins
Pulmonary surfactant associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-C, a component of surfactant, is a highly hydrophobic peptide of 35 amino acid residues which is processed from a larger precursor protein. SP-C is post-translationally modified by the covalent attachment of two palmitoyl groups on two adjacent cysteines
Statistics
?
PSSM-Id: 128335
View PSSM: smart00019
Aligned: 5 rows
Threshold Bit Score: 328.09
Threshold Setting Gi: 1709878
Created: 12-Jul-2011
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 131425      1 MDVGSKEVLMESPPDYSAAPRGRFGIPCCPVHLKRLLIVVVVVVLIVVVIVGALLMGLHMSQKHTEMVLEMSIGAPEAQQ 80
gi 112363115   1 MDVGSKEVLMESPPDYSAAPRGRFGIPCCPVHLKRLLIVVVVVVLVVVVIVGALLMGLHMSQKHTEMVLEMSIGAPEAQQ 80
gi 464484      1 MDVGSKEVLIENPPDYSAAPQGRFGLPCFPSSLKRLLIIVVVIVLVVVVIVGALLMGLHMSQKHTEMVLEMSLGGPEAQQ 80
gi 131426      1 MDMSSKEVLMESPPDYSAGPRSQFRIPCCPVHLKRLLIVVVVVVLVVVVIVGALLMGLHMSQKHTEMVLEMSIGAPETQK 80
gi 1709878     1 MDMGSKEALMESPPDYSAAPRGRFGIPCCPVHLKRLLIVVVVVVLVVVVIVGALLMGLHMSQKHTEMVLEMSIGAPEVQQ 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 131425     81 RLALSEHLVTTATFSIGSTGLVVYDYQQLLIAYKPAPGTCCYIMKIAPESIPSLEALNRKVHNFqmecslQAKPAVPTSK 160
gi 112363115  81 HLARSGHLVTTATFSFGSTGLVVYDYQRLLIAYKPAPGTWCYIMKTAPESIPSLEALTRKVQNF------QAKPAVPTSK 154
gi 464484     81 RLALQERAGTTATFSIGSTGIVVYDYQRLLIAYKPAPGTCCYIMKMAPENIPSLEALTRKFQNF------QVKPAVSTSK 154
gi 131426     81 RLAPSERADTIATFSIGSTGIVVYDYQRLLTAYKPAPGTYCYIMKMAPESIPSLEAFARKLQNF------RAKPSTPTSK 154
gi 1709878    81 RLALSEWAGTTATFPIGSTGIVTCDYQRLLIAYKPAPGTCCYLMKMAPDSIPSLEALARK---F------QANPAEPPTQ 151
                        170       180       190
                 ....*....|....*....|....*....|....*....
gi 131425    161 LGQAEGRDAGSA--PSGGDPAFLGMAVNTLCGEVPLYYI 197
gi 112363115 155 LDQVEGRDAGSA--PSRGDLAFLGMAVSTLCGEVPLYYI 191
gi 464484    155 LGQEEGHNAGSA--SPG-DLDFLGTTVSTLCGEVPLYYI 190
gi 131426    155 LGQEEGHDTGSEsdSSGRDLAFLGLAVSTLCGELPLYYI 193
gi 1709878   152 RGQDKGPAAGPA--SSGGELAFLGAAVSTLCGEVPLIYI 188
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap