Conserved Protein Domain Family
EPEND

?
smart00026: EPEND 
Ependymins
Ependymins are the predominant proteins in the cerebrospinal fluid (CSF) of teleost fish. They have been implicated in the neurochemistry of memory and neuronal regeneration. They are glycoproteins of about 200 amino acids that can bind calcium. Four cysteines are conserved that probably form disulfide bonds.
Statistics
?
PSSM-Id: 128341
View PSSM: smart00026
Aligned: 11 rows
Threshold Bit Score: 324.892
Threshold Setting Gi: 416955
Created: 12-Jul-2011
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 185135605  27 QHCTSPNMTGVLTVMALTGGEIKATGHYSYDSTNKKLRFTESEMHLNKTEHLeDYLMLFEEGVFYDIDMKNQSCKKMSLH 106
gi 585105     25 QPCHSPPLTSGTMKVVSTGGHDLASGEFSYDSKANKFRFVEDTAHANKTSHM-DVLVHFEEGVLYEIDSKNESCKKETLQ 103
gi 2494357    28 QPCHSPQLTSGTMKVISTGGHDLASGEFNYDSKANKFRFVEDTTHANKTSYM-DVLVHFEEGVLYEIDSKNESCKKETLQ 106
gi 212952     26 QPCHSPPLISGTMKVVSTGGHDLASGEFSYDSKANKFRFVEDAAHANKTSHT-DVLVHFEEGTLYEIDSKNESCKKETLQ 104
gi 62578      26 QPCHAPPLTSGTMKVVSTGGHDLESGEFSYDSKANKFRFVEDTAHANKTSHM-DVLIHFEEGVLYEIDSKNESCKKETLQ 104
gi 2494358    25 QPCHSPPLTSGTMKVVSTGGHDLASGEFSYDSKASKFRFVEDT-HANKTSHM-DVLIHFEEGTLYEIDSKNESCKKETLQ 102
gi 62524      27 QPCHSPQLTSGTMKVVSTGGHDLASGEFSYDSKTNKFRFVEDTTHANKTSYI-DVLIHFEEGVLYEIDSKNESCKKETLQ 105
gi 185135590  27 QHCTSPNMTGVLTVLALTGGEIKATGHYSYDSTDKKIRFTESEMHLNKTEHLeDYLMLFEEGVFYDIDMKNQSCKKMSLH 106
gi 119518     27 QHCTSPNMTGVLTVMALTGGEIKATGHYSYDSTDKKLRFTESEMHLNKTEHLeDYLMLFEEGVFYDIDMKNQSCKKMSLH 106
gi 416956     31 QHCTSPNMTGVLTVMALNGGEIKATGHYHYDTTDKKLRFTESDMHLNKSEHLeDYLMLFEEGVFYDIDLKNQSCRKMSLQ 110
gi 416955     23 QPCRPPPQTHGNLWVTAAKGAPASVGEFNYDSQARKLHFKDDALHVNKTDHL-EMLIFFEEGIFYDIDSHNQSCHKKTLQ 101
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 185135605 107 SHAHALELPAGAAHQVELFLGSDTVQEDNIKVNIWMGSVAETKGQYSALTTVGECLPLSTFYSTD-SITLLFSNSEVVTE 185
gi 585105    104 FRKHLMEIPPDATHESEIYMGSPSITEQGLRVRVWNGKLPELHAHYSLSTTSCGCLPVSGSYYGD-KKDLLFSFFGVETE 182
gi 2494357   107 FRKHLMEIPPDATHESEIYMGSPSITEQGLRVRVWNGKLPELHAHYSLSTTSCGCLPVSGSYYGE-KKDLFFSFFGVETE 185
gi 212952    105 FRKHLMEIPPDATHESEIYMGSPSITEQGLRVRVWSGKLPELHAHYSLSITSCGCLPVSGSYYGD-KKDLLFSFFGVETE 183
gi 62578     105 FRKHLMEIPPDATHESEIYMGSPSITEQGLRVRVWNGKFPELHAHYSMSTTSCGCLPVSGSYHGE-KKDLHFSFFGVETE 183
gi 2494358   103 FRKHLMEIPPDATHESEIYMGSPTVIEQGLRVRVWHGKLPELHAHYSLSTTSCGCLPVSGSFYGK-KKDLLFSFFGVEPE 181
gi 62524     106 FRKHLMEIPVDATHESESYMGSPSLTEQGLRVRVWNGKFPELHAHYSLSTTSCGCLTVSGSYYGE-KKDLFFSFFGVETE 184
gi 185135590 107 SHAHALELPAGAAHQVELFLGSDTVQEEDIKVNIWTGSVPETKGQYFLSTTVGECLPLSTFYSTD-SITLLFSNSEVVTE 185
gi 119518    107 SHAHALELPAGAAHQVELFLGSDTVQEENIKVNIWMGSVAETKGQYSVLTTVGECLPLSTFYSTD-SITLLFSNSEVVTE 185
gi 416956    111 SHAHALELPAGAVHQVELFLGSDTVQEENIKVNIWMGSVPETKGQYSVSTTVGDCLPLSTFYSTD-SITLLFSNSQVVTE 189
gi 416955    102 STYHCLEVPPNATHVTEGYLGSEFIGDQGVRMRKWRKRVPELDGVVTVATTSCGCVTLFATLFTDsNDVLVFNFLDVEMK 181
                        170       180       190
                 ....*....|....*....|....*....|....*.
gi 185135605 186 VKAP-EMFTLPSFCEAVELEETPKGqkNDFFNIFNT 220
gi 585105    183 VDDP-QVFVPPAYCEAVAFEEAPDD--HSFFDLFHD 215
gi 2494357   186 VDDP-QVFVPPAYCEGVSFEEAPDD--HSFFDLFHD 218
gi 212952    184 VDDL-QVFVPPAYCEGVAFEEAPDD--HSFFDLFHD 216
gi 62578     184 VDDL-QVFVPPAYCEGVAFEEAPDD--HSFFDLFHD 216
gi 2494358   182 VDDP-QAFVPPAYCEGVSFEEAPDD--HSFFDLFHD 214
gi 62524     185 VDDL-QVFAPPAYCEGVSFEEAPDD--HSFFDLFHD 217
gi 185135590 186 VKAP-EVFNLPSFCEGVELEEAPEGqkNDFFSLFNS 220
gi 119518    186 VKAP-EMFTLPSFCEAVELEETPKGqkNDFFNIFNT 220
gi 416956    190 VKEP-EVFSLPSFCEGLELEDT--H--NDFFSIFNT 220
gi 416955    182 VKNPlEVFVPPSYCDGVALEEEGD----TFFGLFH- 212
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap