3IZ2


Conserved Protein Domain Family
CNX

?
smart00037: CNX 
Click on image for an interactive view with Cn3D
Connexin homologues
Connexin channels participate in the regulation of signaling between developing and differentiated cell types.
Statistics
?
PSSM-Id: 128352
View PSSM: smart00037
Aligned: 30 rows
Threshold Bit Score: 80.5703
Threshold Setting Gi: 126308337
Created: 12-Jul-2011
Updated: 16-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30
                 ....*....|....*....|....*....|....
3IZ2_A        36 EVWGDEQADFVCNTLQPGCKNVCYDHYFPISHIR 69
gi 73993545   43 EVWGDEQSDFTCNTQQPGCENVCYDRAFPISHIR 76
gi 261490652  43 EVWGDEQSDFTCNTQQPGCENVCYDRAFPISHVR 76
gi 1706211    43 SVWGDEQSDFTCNTQQPGCENVCYDWTFPISHIR 76
gi 149409397  43 SAWGDEQSAFRCNTQQPGCENVCYDKSFPISHVR 76
gi 14279163   31 SAWGDEQSAFRCNTQQPGCENVCYDKSFPISHVR 64
gi 147899838  43 SAWGDEQSAFVCNTQQPGCENVCYDKSFPISHVR 76
gi 45382841   43 PLWGDEQSDFMCDTQQPGCENVCYDKAFPISHVR 76
gi 9506727    43 SAWSDEQFEFHCNTQQPGCENVCYDQAFPISHVR 76
gi 169158713  42 SIYYDEQSKFVCNTQQPGCENVCYDAFAPLSHVR 75
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap