1HCN


Conserved Protein Domain Family
GHA

?
smart00067: GHA 
Click on image for an interactive view with Cn3D
Glycoprotein hormone alpha chain homologues.
Also called gonadotropins. Glycoprotein hormones consist of two glycosylated chains (alpha and beta) of similar topology.
Statistics
?
PSSM-Id: 128381
View PSSM: smart00067
Aligned: 10 rows
Threshold Bit Score: 133.02
Threshold Setting Gi: 1346138
Created: 13-Jul-2011
Updated: 16-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1HCN_A         6 DCPECTLQENPFFSQPGA-PILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHC 84
gi 27806913   34 GCPECKLKENKYFSKPDA-PIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNVRVENHTECHC 112
gi 4502787    30 DCPECTLQENPFFSQPGA-PILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHC 108
gi 121306     33 GCEECKLKENNIFSKPGA-PVYQCMGCCFSRAYPTPLRSKKTMLVPKNITSEATCCVAKEFKQV-LVNDIKLVNHTDCHC 110
gi 166706848  34 DCPECKLRENKYFFKLGV-PIYQCKGCCFSRAYPTPARSRKTMLVPKNITSESTCCVAKAFIRVTVMGNIKLENHTQCYC 112
gi 121309     34 GCDECRLQENKIFSKPSA-PIFQCVGCCFSRAYPTPLRSKKTMLVPKNITSEATCCVAREVTR---LDNMKLENHTDCHC 109
gi 29289971   29 GCEECTLKPNTIFPN-----IMQCTGCCFSRAYPTPLRSKQTMLVPKNITSEATCCVAKEGERVTTKDGFPVTNHTECHC 103
gi 399546     33 GCEACTLRKNTVFSRDR--PIYQCMGCCFSRAYPTPLKAMKTMTIPKNITSEATCCVAKHVYE-TEVAGIRVRNHTDCHC 109
gi 1346138    40 ACGECSLGLNRLFSRDR--PLYQCMGCCFSRAYPTPQTAIQTMAIPKNITSEAKCCVAKHSYE-TKVDDITVRNHTECHC 116
gi 121319     10 GCPECRLKENLRFSNMGIgRIYQCSGCCYSRAYPTPMRSKKTMLVPKNITSEAKCCVAKTQYRVTVMDNVKIENHTACHC 89

                 ....*...
1HCN_A        85 STCYYHKS 92
gi 27806913  113 STCYYHKS 120
gi 4502787   109 STCYYHKS 116
gi 121306    111 STCYYHKS 118
gi 166706848 113 STCYHHKI 120
gi 121309    110 STCYYHKF 117
gi 29289971  104 STCYYHKS 111
gi 399546    110 STCYYHKI 117
gi 1346138   117 STCYYHKL 124
gi 121319     90 STCLYHKS 97
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap