Conserved Protein Domain Family
Galanin

?
smart00071: Galanin 
Galanin
Galanin is a neuropeptide that controls various biological activities: it regulates the release growth hormone, inhibits the release of insulin and somatostatin, contracts smooth muscle of the gastrointestinal and genitourinary tract and may be involved in the control of adrenal secretion
Statistics
?
PSSM-Id: 128385
View PSSM: smart00071
Aligned: 5 rows
Threshold Bit Score: 181.228
Threshold Setting Gi: 73983582
Created: 13-Jul-2011
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6753940   21 TLGLGMPAKEKRGWTLNSAGYLLGPHAIDNHRSFSDKHGLTGKRELQLEVeERRPGSVDVPLPESNI--VRTIMEFLSFL 98
gi 47523542  21 TLGLGSPVKEKRGWTLNSAGYLLGPHAIDNHRSFHDKYGLAGKRELEPED-EARPGGFDRLQSEDKA--IRTIMEFLAFL 97
gi 190412     5 SAGLWSPAKEKRGWTLNSAGYLLGPHAVGNHRSFSDKNGLTSKRELRPED-DMKPGSFDRSIPENNI--MRTIIEFLSFL 81
gi 27806883  21 tlglGSPVKEKRGWTLNSAGYLLGPHALDSHRSFQDKHGLAGKRELEPED-EARPGSFDRPLAENNV--VRTIIEFLTFL 97
gi 73983582 126 mtllpfeVKEKRGWTLNSAGYLLGPHAIDNHRSFHEKPGLTGKRELPPED-EGRSGGFAGPLSLSENaaVRMLIEFLTFL 204
                        90       100
                ....*....|....*....|....*.
gi 6753940   99 HLKEAGALDSLPGIPLATSSEDLEKS 124
gi 47523542  98 HLKEAGALGRLPGLPSAASSEDAGQS 123
gi 190412    82 HLKEAGALDRLLDLPAAASSEDIERS 107
gi 27806883  98 HLKDAGALERLPSLPTAESAEDAERS 123
gi 73983582 205 RLKEAGALPDLPDLPSAVSAEDMEQp 230
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap