2Z15


Conserved Protein Domain Family
btg1

?
smart00099: btg1 
Click on image for an interactive view with Cn3D
tob/btg1 family
The tob/btg1 is a family of proteins that inhibit cell proliferation.
Statistics
?
PSSM-Id: 128410
View PSSM: smart00099
Aligned: 5 rows
Threshold Bit Score: 191.19
Threshold Setting Gi: 147902557
Created: 13-Jul-2011
Updated: 16-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2Z15_A         8 MQLEIQVALNFIISYL--YNKLPRRRVNIFGEELERLLKKKYEGHWYPEKPYKGSGFRCIHIG--EKVDPVIEQASKESG 83
gi 296212508 100 MIGEIAAAVSFISKFLrtKGLTSERQLQTFSQSLQELLAEHYKHHWFPEKPCKGSGYRCIRIN--HKMDPLIGQAAQRIG 177
gi 60833689    1 MQLEIQVALNFIISYL--YNKLPRRRVNIFGEELERLLKKKYEGHWYPEKPYKGSGFRCIHIG--EKVDPVIEQASKESG 76
gi 149059720   8 MKNEIAAVVFFFTRLVrkHDKLKKEAVERFAEKLTQILQEKYKNHWYPEKPSKGQAYRCIRVNkfQRVDPDVLKACENSC 87
gi 147902557   1 MKEEIAATVVFLTMLVkkHKQLSKQKIEKFAAKLTTILFAKYKNHWYAENPMKGQAFRCIRINtyQAIDAVFEKACAESN 80
                         90       100       110
                 ....*....|....*....|....*....|
2Z15_A        84 LDIDDVRgnLPQDLSVWIDPFEVSYQIGEK 113
gi 296212508 178 LSSQELFrlLPSELTLWVDPYEVSYRIGED 207
gi 60833689   77 LDIDDVRgnLPQDLSVWIDPFEVSYQIGEK 106
gi 149059720  88 ILYSDLG--LPKELTLWVDPCEVCCRYGEK 115
gi 147902557  81 VDFNDLG--LPKEMTIWVDPFEVCCRYGEK 108
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap