1I1R,1BGC


Conserved Protein Domain Family
IL6

?
smart00126: IL6 
Click on image for an interactive view with Cn3D
Interleukin-6 homologues
Family includes granulocyte colony-stimulating factor (G-CSF) and myelomonocytic growth factor (MGF). IL-6 is also known as B-cell stimulatory factor 2.
Statistics
?
PSSM-Id: 128431
View PSSM: smart00126
Aligned: 9 rows
Threshold Bit Score: 172.964
Threshold Setting Gi: 157830293
Created: 12-Jul-2011
Updated: 16-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1I1R_B        16 LNWMLWVIDECFRDLCYRTGICKGILEPAAIFHLKLPAINDTDHCGLIGFNETSCLKKLADGFFEFEVLFKFLTTEFGK- 94
gi 112293291  57 IRYILDGISALRKETCNRSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEDTCLVKIITGLLEFEVYLEYLQNRFES- 135
gi 126723700  54 IKYILGKISALKNEMCNNFSKCENSKEVLAENNLNLPKMAEKDGCFQSGFNQETCLMKITTGLSEFQIYLEYLQNEFKG- 132
gi 46561780  167 ITHVLWEIVEMRKELCNGNSDCMNNDDALAENNLKLPEIQRNDGCYQTGYNQEICLLKISSGLLEYHSYLEYMKNNLKD- 245
gi 6016363    50 ISYLIKEVFEMRKELCKNDETCIKSHVAVSENNLNLPKMTEKDGCFQTGYNRDDCLVRITSGLLEFQVYLRYIRNKFQEg 129
gi 81965467   39 LNWMLWVIDECFRDLCYRTGICKGILEPAAIFHLKLPAINDTDHCGLIGFNETSCLKKLADGFFEFEVLFKFLTTEFGK- 117
gi 2497343    57 IKHIVDKISAIRKEICEKNDECENSKETLAENKLKLPKMEEKDGCFQSGFNQAICLIKTTAGLLEYQIYLDFLQNEFEG- 135
gi 45384140   46 TRKIRGDVAALQRAVCDTFQLCTEEELQLVQPDPHLVQA-PLDQCHKRGFQAEVCFTQIRAGLHAYHDSLGAVLRLLPN- 123
1BGC_A        21 VRKIQADGAELQERLCAAHKLCHPEELMLLRHSLGIPQA-PLSSCSSQSLQLRGCLNQLHGGLFLYQGLLQALAGISPE- 98
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
1I1R_B        95 -S-VINVDVMELLTKTLGWDIQEELNKLTKTHYSPPKFDRGLLGRLQGLKYWVRHFASFYVLSAMEKFAGQAVRVLD 169
gi 112293291 136 -S-EEQARAVQMSTKVLIQFLQKKAKNLDAITTPEPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSNLRALR 210
gi 126723700 133 -E-KENIKTMQISTKVLVQILMQKMKNPE-VTTPDPTAKSSLLAKLHSQNEWLKNTTTHLILRSLEDFLQFSLRAVR 206
gi 46561780  246 -NkKDKARVLQRDTETLIHIFNQEVKDLHKIVLPTPISNALLTDKLESQKEWLRTKTIQFILKSLEEFLKVTLRSTR 321
gi 6016363   130 nN-RDRAEHVQSSSKALIEILKQEVKDPNKIVFPSPTANINLLAKLESQNDWQKVMTMQLILSNFEDFLQFTLRAVR 205
gi 81965467  118 -S-VINVDVMELLTKTLGWDIQEELNKLTKTHYSPPKFDRGLLGRLQGLKYWVRHFASFYVLSAMEKFAGQAVRVLD 192
gi 2497343   136 -N-QETVMELQSSIRTLIQILKEKIAGLI----TTPATNTDMLEKMQSSNEWVKNAKVIIILRSLENFLQFSLRAIR 206
gi 45384140  124 -H-TTLVETLQLDAANLSSNIQQQMEDLGLDTVTLPAEQRSPPPTFSGPFQ--QQVGGFFILANFQRFLETAYRALR 196
1BGC_A        99 -L-APTLDTLQLDVTDFATNIWLQMEDLG--AAPAVQPTQGAMPTFTSAFQ--RRAGGVLVASQLHRFLELAYRGLR 169
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap