3DI2


Conserved Protein Domain Family
IL7

?
smart00127: IL7 
Click on image for an interactive view with Cn3D
Interleukin-7 and interleukin-9 family.
IL-7 is a cytokine that acts as a growth factor for early lymphoid cells of both B- and T-cell lineages. IL-9 is a multifunctional cytokine that, although originally described as a T-cell growth factor, its function in T-cell response remains unclear.
Statistics
?
PSSM-Id: 128432
View PSSM: smart00127
Aligned: 6 rows
Threshold Bit Score: 234.562
Threshold Setting Gi: 3024010
Created: 12-Jul-2011
Updated: 16-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DI2_A        4 CDIEGKDGKQYESVLMVSIDQLlDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLK 83
gi 57526367  27 CDFSGKDGGAYQNVLMVSIDDL-DNMINFDSNCLNNEPNFFKKHSCDDNKEASFLNRAARKLKQFLKMNISDDFKLHLST 105
gi 124353    27 CDISGKDGGAYQNVLMVNIDDL-DNMINFDSNCLNNEPNFFKKHSCDDNKEASFLNRASRKLRQFLKMNISDDFKLHLST 105
gi 6680433   27 CHIKDKEGKAYESVLMISIDEL-DKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLT 105
gi 3024010   27 CHIKDKDGKAFGSVLMISINQL-DKMTGTDSDCPNNEPNFFKKHLCDDTKEAAFLNRAARKLRQFLKMNISEEFNDHLLR 105
gi 60828395  27 CDIEGKDGKQYESVLMVSIDQLlDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLK 106
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|....*..
3DI2_A       84 VSEGTTILLNCTGQVKGRKPAALGAAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMG 150
gi 57526367 106 VSQGTLTLLNCTSKGKGRKPPSLGEAQPTKNLEENKSLKEQRKQNDLCFLKILLQKIKTCWNKILRG 172
gi 124353   106 VSQGTLTLLNCTSKGKGRKPPSLSEAQPTKNLEENKSSKEQKKQNDLCFLKILLQKIKTCWNKILRG 172
gi 6680433  106 VSQGTQTLVNCTSK-------------------EEKNVKEQKK-NDACFLKRLLREIKTCWNKILKG 152
gi 3024010  106 VSDGTQTLVNCTSK-------------------EEKTIKEQKK-NDPCFLKRLLREIKTCWNKILKG 152
gi 60828395 107 VSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMG 173
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap