3OHM,2FJU,1QAS


Conserved Protein Domain Family
PLCYc

?
smart00149: PLCYc 
Click on image for an interactive view with Cn3D
Phospholipase C, catalytic domain (part); domain Y
Phosphoinositide-specific phospholipases C. These enzymes contain 2 regions (X and Y) which together form a TIM barrel-like structure containing the active site residues. Phospholipase C enzymes (PI-PLC) act as signal transducers that generate two second messengers, inositol-1,4,5-trisphosphate and diacylglycerol. The bacterial enzyme appears to be a homologue of the mammalian PLCs.
Statistics
?
PSSM-Id: 128454
View PSSM: smart00149
Aligned: 29 rows
Threshold Bit Score: 154.704
Threshold Setting Gi: 190407698
Created: 12-Jul-2011
Updated: 16-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3OHM_B       590 STLVNYIEPVKFKSFEAARKRnK-CFEMSSFVETKA-MEQLTKSPM-EFVEYNKQQLSRIYPKGTRVDSSNYMPQLFWNV 666
gi 238479688 317 KHLIAIHAGKPKGGITECLKVdPdKVRRLSLSEEQL-EKAAEKYAK-QIVRFTQHNLLRIYPKGTRVTSSNYNPLVGWSH 394
gi 4467140   258 RDLIAIHAANCKDPSKDCLSDdPeKPIRVSMDEQWL-DTMVRTRGT-DLVRFTQRNLVRIYPKGTRVDSSNYDPHVGWTH 335
gi 1399303   290 KRLITIHAGKPKGHVKHHLNNvG-GVKRLSLSEQEL-EKASATYGS-DIVRFTQKNIIRVYPKGTRVTSSNYRPHIGWMY 366
gi 2769704   294 RDLISIHAGNRKGGLKNCLNGdPnRVIRLSMSEQWL-ETLAKTRGP-DLVKFTQRNLLRIFPKTTRFDSSNYDPLVGWIH 371
gi 1786115   286 KRLITIHAGKPKGEIQDELKAaG-NVRRLSLSEQAL-EKASESYGA-DVVRFTHNNILRVYPKGTRLNSSNYKPHIGWTY 362
gi 66801101  539 FEELIYLVSHGFKSGNTTKEI-P-SYKIHSLVEEKV-KQLVQSEPR-EVVEASQNHLLRVYPRGTRFDSSNFDPMPGWSI 614
gi 17541792  495 SALIGLPSVKLSHNIYQDVNKhP-FDGSPSLSENKV-YTMFEAAVP--IFTYTAERLVKSYPKGLRQDSSNMHPMVSWLC 570
gi 619519    639 QQLAPYARSLKFRNFSLPESK-T-YSHIFSFSERTI-KKHGKAMVP-RLSKHNLRYLCRVYPGPLRVGSTNFNPQVYWRL 714
gi 190407698 587 VSNISGIHGIKFRNFSLPESK-T-IAHCFSLNERKVeYMIKDKHLKlSLDKHNRRYLMRVYPHVLRYKSSNFNPIPFWKA 664
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*
3OHM_B       667 GCQLVALNFQTLDVAMQLNAGVFEYNGR-------SGYLLKPEFM 704
gi 238479688 395 GAQMVAFNMQGYGRSLWLMQGMFRANGG-------CGYIKKPDLL 432
gi 4467140   336 GAQMVAFNMQGHGKQLWIMQGMFRGNGG-------CGYVKKPRIL 373
gi 1399303   367 GAQMVAFNMQGHGKSLWYMQGMFRANGG-------CGYVKKPAFL 404
gi 2769704   372 GAQMVAFNMQSHGRYLWMMQGMFKANGG-------CGYVKKPDVL 409
gi 1786115   363 GAQMVAFNMQGHGKSLWYMQGMFRSNGG-------CGYVKKPNFL 400
gi 66801101  615 GCQLAALNQQTSSEPMWINDGMFSDNGG-------CGYVLKPPCL 652
gi 17541792  571 GIQSVAMNFQTAGEELDLNAGLFRINGN-------CGYVLKPSCL 608
gi 619519    715 GVQMVALNWQTYDTGLQINDALFIADPP-------TGYLLKPPCQ 752
gi 190407698 665 GVQMVATNWQTNDIGQQLNLAMFQILDHqpdgsfkSGYVLKPKKL 709
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap