Conserved Protein Domain Family
THY

?
smart00152: THY 
Thymosin beta actin-binding motif.
Statistics
?
PSSM-Id: 128457
View PSSM: smart00152
Aligned: 4 rows
Threshold Bit Score: 44.1212
Threshold Setting Gi: 195564992
Created: 12-Jul-2011
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30
                 ....*....|....*....|....*....|....*..
gi 74957545   51 IHEIEHFDSTKLHSTPVKEKIVLPSADDIKQEKQHLE 87
gi 296190499  68 MAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGE 104
gi 17551492   89 TDKINNFPSENLKKTETIEKNVLPSPTDVAREKTLQM 125
gi 195564992  57 FEGITAFNQNNLKHTETNEKNPLPDKEAIEQEKEKNQ 93
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap