1UJS,1YU8,2K6M,1QZP,1UND


Conserved Protein Domain Family
VHP

?
smart00153: VHP 
Click on image for an interactive view with Cn3D
Villin headpiece domain
Statistics
?
PSSM-Id: 128458
View PSSM: smart00153
Aligned: 20 rows
Threshold Bit Score: 56.1733
Threshold Setting Gi: 253723149
Created: 12-Jul-2011
Updated: 16-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30
               ....*....|....*....|....*....|....*.
1UJS_A      47 HLSQEEFYQVFGMTISEFDRLALWKRNELKKQARLF 82
gi 3415117 931 YLSEVEFKTVFGMEKESFYKLPGWKQDLLKKKFNLF 966
gi 3093294 939 YLSSEEFKEKFGMTKEAFYKLPKWKQNKFKMAVQLF 974
gi 3415113 875 YLTEKEFEERFGMAKSEFYALPKWKQNKLKISLHLF 910
gi 2119332 370 HLSAEDFSRVFAMSPEEFGKLALWKRNELKKKASLF 405
gi 4240175 648 HLSQEEFYQVFGMTISEFDRLALWKRNELKKQARLF 683
gi 2501655 852 HLTHDDFVSVFNMSFYEFDELPKWKKMELKKQFKLF 887
gi 505094  427 HLAPEVFREIFGMSIQEFDRLPLWRRNDMKKKAKLF 462
gi 549325  924 YLSDEEFLSTFKMTKEIFQKTPAWKTKQLRVDNGLF 959
1QZP_A      33 HLSAEDFSRVFAMSPEEFGKLALWKRNELKKKASLF 68
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap