1GNH,1SAC


Conserved Protein Domain Family
PTX

?
smart00159: PTX 
Click on image for an interactive view with Cn3D
Pentraxin / C-reactive protein / pentaxin family
This family form a doscoid pentameric structure. Human serum amyloid P demonstrates calcium-mediated ligand-binding.
Statistics
?
PSSM-Id: 128463
View PSSM: smart00159
Aligned: 38 rows
Threshold Bit Score: 266.055
Threshold Setting Gi: 117482
Created: 12-Jul-2011
Updated: 16-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1GNH_A         1 QTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSsT-RGYSIFSYATKRQDNEILIFWSKDIGYSFTVGG 79
gi 289629230 215 FKSPDAFKVSLPFRTNYLYGKIKKTLP-ELYSFTICLWLRSSAS-P-GIGTPFSYAVPGQANEIVLIEWGNNPIELLIND 291
gi 881934    183 FKSPDAFKVSLPLRTNYLYGKIKKTLP-ELYAFTICLWLRSSAS-P-GIGTPFSYAVPGQANEILLIEWGNNPIELLIND 259
gi 77736539  220 FKSPDAFKVSLPLRTNYLYGKIKKTLP-ELYAFTICLWLRSSAS-P-GIGTPFSYAVPGQANEIVLIEWGNNPIELLIND 296
gi 55770878  222 NRPGDKFQLTFPLRTNYMYAKVKKSLP-EMYAFTVCMWLKSSAT-P-GVGTPFSYAVPGQANELVLIEWGNNPMEILIND 298
gi 24308510  222 NRPGDKFQLTFPLRTNYMYAKVKKSLP-EMYAFTVCMWLKSSAA-P-GVGTPFSYAVPGQANELVLIEWGNNPMEILIND 298
gi 18202030  282 YSPPDAFKVSIPIRNNYMYARVRKAVP-ELYAFTACMWLRSRSG-GsGQGTPFSYSVPGQANEIVLLEAGLEPMELLIND 359
gi 1345831    27 EGEITSKVKFPPSSSPSFPRLVMVGTLPDLQEITLCYWFKVNHL-K-STLTIFSYNTAKNDNELLTSLEKQGAFHMNVHG 104
gi 117482     27 EGEITSKVKFPPSSSPSFPRLVMVGTLPDLQEITLCYWFKVNCL-K-GTLHMFSYATAKKDNELLTLLDEQGDFLFNVHG 104
gi 339992    175 LPAGCETAILFPMRSKKIFGSVHPVRPLRLESFSACIWVKATDV-L-NKTILFSYGTKRNPYEIQLYLSYQSIVFVVGGE 252
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1GNH_A        80 S---EILFEVPEVTVAPVHICTSWESASGIVEFWVDG-KP-R--VRKSLKKGYTVGAEASIILGQEQD--SFGGNFEGSQ 150
gi 289629230 292 K---VAQLPLFVSDGKWHHICITWTTRDGLWEAFQDGeKL-G--TGENLAPWHPIKSGGVLILGQEQD--TVGGRFDATQ 363
gi 881934    260 K---VAQLPLFVSDGKWHHICVTWTTRDGMWEAFQDGeKL-G--TGENLAPWHPIKPGGVLILGQEQD--TVGGRFDATQ 331
gi 77736539  297 K---VAQLPLFVSDGKWHHICITWTTRDGMWEAFQDGeKL-G--TGENLAPWHPIKPGGVLILGQEQD--TVGGRFDATQ 368
gi 55770878  299 K---VAKLPFVINDGKWHHICVTWTTRDGVWEAYQDG-TQgG--SGENLAPYHPIKPQGVLVLGQEQD--TLGGGFDATQ 370
gi 24308510  299 K---VAKLPFVINDGKWHHICVTWTTRDGVWEAYQDG-TQgG--NGENLAPYHPIKPQGVLVLGQEQD--TLGGGFDATQ 370
gi 18202030  360 K---VAQLPLSLKDSNWHHICIAWTTRDGLWSAYQDG-EL-Rg-SGENLAAWHPIKPHGILILGQEQD--TLGGRFDATQ 431
gi 1345831   105 ApqlKVQCPNKIHIGKWHHVCHTWSSWEGEATIGVDG-FH-CkgNATGIAMGVTLSQGGLVVLGQEQD--SVGGEYDAEQ 180
gi 117482    105 ApqlKVQCPNKIHIGKWHHVCHTWSSWEGEATIAVDG-FH-CkgNATGIAVGRTLSQGGLVVLGQDQD--SVGGKFDATQ 180
gi 339992    253 En--KLVAEAMVSLGRWTHLCGTWNSEEGLTSLWVNG-EL-Aa-TTVEMATGHIVPEGGILQIGQEKNgcCVGGGFDETL 327
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
1GNH_A       151 SLVGDIGNVNMWDFVLSPDEINTIYLGGPFS-----PNVLNWRALKYEVQGEVFTKPQLWP 206
gi 289629230 364 AFVGELSQFNIWDRVLRPQEISNIANCSLNMa----GNIIPWVDNNVDVFGGASKWPVETC 420
gi 881934    332 AFVGELSQFNIWDRVLRAQEIVNIANCSTNMp----GNIIPWVDNNVDVFGGASKWPVETC 388
gi 77736539  369 AFVGELSQFNIWDRVLRAQEIINIANCSTNMp----GNIIPWVDNNVDVFGGASKWPVETC 425
gi 55770878  371 AFVGELAHFNIWDRKLTPGEVYNLATCSTKAl---sGNVIAWAESHIEIYGGATKWTFEAC 428
gi 24308510  371 AFVGELAHFNIWDRKLTPGEVYNLATCSSKAl---sGNVIAWAESQIEIFGGATKWTFEAC 428
gi 18202030  432 AFVGDIAQFNLWDHALTPAQVLGIANCTGPLm----GNVLPWEDKLVEAFGGAKKAAFDVC 488
gi 1345831   181 SLEGELSELNLWNTVLNHEQIKHLSKCAHPSerhihGNIIQWDKTQFQAYDGVVLSPNEIC 241
gi 117482    181 SLEGELSELNLWNTVLNHEQIKYLSKCAHPSerhiyGNIIQWDKTQFKAYDGVVLSPNEIC 241
gi 339992    328 AFSGRLTGFNIWDSVLSNEEIRETGGAESCHi---rGNIVGWGVTEIQPHGGAQYVS---- 381
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap