Conserved Protein Domain Family
VPS9

?
smart00167: VPS9 
Domain present in VPS9
Domain present in yeast vacuolar sorting protein 9 and other proteins.
Statistics
?
PSSM-Id: 128469
View PSSM: smart00167
Aligned: 6 rows
Threshold Bit Score: 141.439
Threshold Setting Gi: 323346211
Created: 12-Jul-2011
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1695233    489 PVELEQVRQKLLQLVRtySPSAQVKRLLQACKLLYMALRTQE-GEGSGADGFLPLLSLVLAHCDLPELLLEAEYMSELLE 567
gi 119630622  442 FVDVEKIKVKFMTMQKmySPEKKVMLLLRVCKLIYTVMENNS-GRMYGADDFLPVLTYVIAQCDMLELDTEIEYMMELLD 520
gi 259148478  205 FVHLASKELGKINRFK--SPRDKMVCVLNASKVIFGLLKHTK-LEQNGADSFIPVLIYCILKGQVRYLVSNVNYIERFRS 281
gi 28202254   489 PVEIEPVRQKLLQLLRaySPSAQIKWLLQACKLLYTALKTQA-GENAGADEFLPLLSLVLAQCDLPDLLLEAEYMSELLE 567
gi 323346211  313 FEEIKDILYEFTYHSI--SPCEKIKALLKLHEIMTYSQE-------MSNDDYLSLLIYYIITIVPRDIFLNAEFIRLFRY 383
gi 71991101   990 PWPSAQAELSMLDIYV--TAQDKLNCVVRCCDVINNLVALSSkNAVASADDLTPVLVFVIIKANPRALLSNVQFVETFAG 1067
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|
gi 1695233    568 PSLLTGEGGYYLTSLSASLALLSGLGQAHTLPLSPVQELR 607
gi 119630622  521 PSLLHGEGGYYLTSAYGALSLIKNFQEEQAARLLSSETRD 560
gi 259148478  282 PDFIRGEEEYYLSSLQAALNFIMSLTERSLTIDDHEDFEE 321
gi 28202254   568 PTLLTGEGGYYLTSLSASLALLSGLSQAHALPLSPAQELQ 607
gi 323346211  384 KKKLVETESFALTNLEAALVFVEGLTKNDfsnelqdkltv 423
gi 71991101  1068 DRIESGRDAYYWVNFKSAVEYIKTIL-------------- 1093
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap