3G5B


Conserved Protein Domain Family
ZU5

?
smart00218: ZU5 
Click on image for an interactive view with Cn3D
Domain present in ZO-1 and Unc5-like netrin receptors
Domain of unknown function.
Statistics
?
PSSM-Id: 128514
View PSSM: smart00218
Aligned: 10 rows
Threshold Bit Score: 136.712
Threshold Setting Gi: 20043235
Created: 12-Jul-2011
Updated: 16-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3G5B_A          1 PGSSVSGTFGCLGGRLTIPG-TGVSLLVPNGAIPQGKFYDLYLRINKTESTLPLS--EGSQTVLSPSVTCGP-------T 70
gi 2055392    495 TSNMAYGTFNFLGGRLMIPN-TGISLLIPPDAIPRGKIYEIYLTLHKPEDVRLPL--AGCQTLLSPVVSCGP-------P 564
gi 2055394    541 PSSSVSGTFGCLGGRLTIPG-TGVSLLVPNGAIPQGKFYDLYLRINKTESTLPLS--EGSQTVLSPSVTCGP-------T 610
gi 160707915  952 TGFLVSFMVDARGGSMRGSRhNGLRVVIPPRTCAAPTRITCRLVKPQKLNTPPPL--AEEEGLASRIIALGP-------T 1022
gi 739514     966 SGFLVIFMVDARGGAMRGCRhNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPM--VEGEGLASRLIEVGP-------S 1036
gi 71981389  1000 PSFLISFLVDARGGAMRGCRhSGVRIIVPPRKASQPIRVTCRYLRKDKLAHPPPL--SEGEELASRILEMAP-------A 1070
gi 2088527    528 PSCTAFGTFNSLGGHLIIPN-SGVSLLIPAGAIPQGRVYEMYVTVHRKENMRPPM--EDSQTLLTPVVSCGP-------P 597
gi 28558750   930 LGFLVSFLVDARGGSMRGYRhNGVRIIVPPKACAEPTRITCRYVKPQRVVNPPPL--MEGEALVSRILEMSP-------V 1000
gi 296203927 1632 VVATARGIFNSNGGVLSSIE-TGVSIIIPQGAIPEGVEQEIYFKVCRDNSILPPLdkEKGETLLSPLVMCGP-------H 1703
gi 20043235   528 SQNIVAAQIDSNGARLSLSK-SGARLIVPELAVE--GEKMLYLAVSDTLTDQPHL--KPIESALSPVIVIGQcdvsmsaH 602
                          90       100       110
                  ....*....|....*....|....*....|....*
3G5B_A         71 GLLLCRPVVLTVPHCAEVIAGD-WIFQLKTQAHQG 104
gi 2055392    565 GVLLTRPVILAMDHCGEPSPDS-WSLRLKKQSCEG 598
gi 2055394    611 GLLLCRPVVLTVPHCAEVIAGD-WIFQLKTQAHQG 644
gi 160707915 1023 GAQFLSPVIVEIPHFASHGRGD-RELVVLRSENGS 1056
gi 739514    1037 GAQFLGPVIVEIPHFAALRGKE-RELVVLRSENGD 1070
gi 71981389  1071 GAKFLGPVILEVPHFASLRDRE-REIVILRSDDGQ 1104
gi 2088527    598 GALLTRPVILTLHHCADPSTED-WKIQLKNQAVQG 631
gi 28558750  1001 DGMFLSPITLEVPHYGTLRKNE-REIIILRSDNGE 1034
gi 296203927 1704 GLKFLKPVELRLPHCDPKTWQNkCLPGDPNYLVGA 1738
gi 20043235   603 DNILRRPVVVSFRHCASTFPRDnWQFTLYADEGSG 637
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap