Conserved Protein Domain Family
NEBU

?
smart00227: NEBU 
The Nebulin repeat is present also in Las1.
Tandem arrays of these repeats are known to bind actin.
Statistics
?
PSSM-Id: 128523
View PSSM: smart00227
Aligned: 107 rows
Threshold Bit Score: 26.6596
Threshold Setting Gi: 57208758
Created: 12-Jul-2011
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30
                  ....*....|....*....|....*....|.
gi 81886646   483 YTLPQDAPQLLKAKANAELFSEVKYKEGWQK 513
gi 57208758    86 YKRMPATIDSVFAGEVTQLQSEVAYKQKHDA 116
gi 148669805  253 FPAMI-TPAYQIAKRATELASDVRYHQQYHR 282
gi 74223837   264 SLAAQDNLVLKRAQSVSKLVSENKYKENYQT 294
gi 2351568    168 FPAMI-TPAYQRAKAANQLASQVQYKRGHDE 197
gi 83405493   139 YAHMKEPPEVKHAMEVNKHQSNISYRKDVQD 169
gi 119606579  207 EPAVIGRPDFEHAVEASKLSSQIKYKEKFDN 237
gi 116283490  148 CHVDEKAKDIEHAKKVSQQVSKVLYKQNWED 178
gi 119606579  527 MQVSMDIPDILRAKRTSEIYSQRKYKDEAEK 557
gi 2351568    307 FPAMI-TPAYQTAKKANELVSDIKYRQDFHK 336
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap