Conserved Protein Domain Family
OLF

?
smart00284: OLF 
Olfactomedin-like domains
Statistics
?
PSSM-Id: 128580
View PSSM: smart00284
Aligned: 4 rows
Threshold Bit Score: 423.86
Threshold Setting Gi: 585611
Created: 13-Jul-2011
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4164071   205 GLLKGVYQSEHLFESD---H---QSGAWCKDPLQAS----DKIYYMPWTP--YRTDTLTEYSSKDDFIAGRPTTTYKLPH 272
gi 3845607   244 GVLMWVGEPVTLRTAEtitG---KYGVWMRDPKPTHpytqETTWRIDTVG--TGIRQVFEYSQISQFEQGYPSKVHVLPQ 318
gi 17865343  228 GKLTGISDPVTVKTSG---S---RFGSWMTDPLAPEg--dNRVWYMDGY---HNNRFVREYKSMVDFMNTDNFTSHRLPH 296
gi 585611    196 QGLAHISKPNLMQLNWk--GnayKSGAWGKDAAWNTtk-kSLYWVAPLNTdgRVLESIRIYPSMSDLQMYKNPIDLPLSM 272
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4164071   273 ----------RVDGTGFVVYDGALFFNKERTRNIVKFDLRTRIKSGEAIIANANYHDTSPYRWGGKSDIDLAVDENGLWV 342
gi 3845607   319 ----------ALESTGAVVYAGSLYFQGAESRTVLRYELNTETVKAEKEIPGAGYHGQFPYAWGGYTDIDLAVDESGLWV 388
gi 17865343  297 ----------PWSGTGQVVYNGSIYFNKFQSHIIIRFDLKTETILKTRSLDYAGYNNMYHYAWGGHSDIDLMVDENGLWA 366
gi 585611    273 liknklnntfAGQGAGVVVHNNNLYYNCFNSHDMCRASLTSGVYQKKPLLN-ALFNNRFSYAGTMFQDMDFSSDEKGLWV 351
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4164071   343 IYATEQNNGKIVISQLNPYTLRIEGTWDTAYDKRSASNAFMICGILYVVKSvyedddNEATGNKIDYIYNTDQSKDSLVD 422
gi 3845607   389 IYSTEETRGAIVLSKLNPENLELESTWETNIRKQSVANAFVICGILYTVSS------YSSVHATINFAYDTNTGISKTLT 462
gi 17865343  367 VYATNQNAGNIVISKLDPVSLQILQTWNTSYPKRSAGEAFIICGTLYVTN-------GYSGGTKVHYAYQTNASTYEYID 439
gi 585611    352 IFTTEKSAGKIVVGKVNVATFTVDNIWITTQNKSDASNAFMICGVLYVTRS------LGPKMEEVFYMFDTKTGKEGHLS 425
                        250       260       270
                 ....*....|....*....|....*....|....*....
gi 4164071   423 VPFPNSYQYIAAVDYNPRDNLLYVWNNYHVVKYSLDFGP 461
gi 3845607   463 IPFKNRYKYSSMVDYNPLERKLFAWDNFNMVTYDIKLSE 501
gi 17865343  440 IPFQNKYSHISMLDYNPKDRALYAWNNGHQTLYNVTLFH 478
gi 585611    426 IMMEKMAEKVHSLSYNSNDRKLYMFSEGYLLHYDIALKP 464
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap