Conserved Protein Domain Family
HALZ

?
smart00340: HALZ 
homeobox associated leucin zipper
Statistics
?
PSSM-Id: 128634
View PSSM: smart00340
Aligned: 11 rows
Threshold Bit Score: 69.7884
Threshold Setting Gi: 75102369
Created: 13-Jul-2011
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....
gi 75281909  169 KQTEVDCEFLKRCCENLTEENRRLQKEVQELRALKLSPQFYMHM 212
gi 75102171  150 KQTEVDCEYLKRCCNTLTDENQRLRQEVQELKAQKVSPALYMQL 193
gi 75102369  212 KQTEVDCELLKRCCETLTDENRRLHRELQELRALKLATAAAAPH 255
gi 75099601  203 KQTEVDYALLKKCCETLTEENRKLQKEVQELKALKLAQSPLYMH 246
gi 297810781 245 KQTEVDCEYLKRCCESLTEENRRLQKEVKELRTLKTSTPFYMQL 288
gi 15227754  168 KQTEVDCEFLKKCCETLADENIRLQKEIQELKTLKLTQPFYMHM 211
gi 3868831   248 KQTEVDCELLKRCCESLTEENRRLQKEVAELRALKGGSPLCYIP 291
gi 3868833   113 KQTEVDCELLKRCCESLTEENRRLQKEVQELRALKVTAPRVIAH 156
gi 21592922  190 KQTEVDCEYLKRCVEKLTEENRRLEKEAAELRALKLSPRLYGQM 233
gi 30677923  194 KQTEMECEYLKRWFGSLTEENHRLHREVEELRAMKVGPTTVNSA 237
gi 3868845   134 KQTEVDCELLRKCCASLTEENRRLQMEVDQLRALSTTQLHFSDF 177
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap