Conserved Protein Domain Family
ZnF_CHCC

?
smart00400: ZnF_CHCC 
zinc finger
Statistics
?
PSSM-Id: 128681
View PSSM: smart00400
Aligned: 17 rows
Threshold Bit Score: 93.8962
Threshold Setting Gi: 9630442
Created: 12-Jul-2011
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 332998669  36 FHACCPFHNEKTPSFTVNGEKQFYHCFGCGAHGNAIDFLMNYDKLEFVETVEELA 90
gi 326406053  35 YIGLCPFHGEKTPSFNVNAEKGFYHCFGCGRSGDAIEFLKEYNQVGFVDAVKELA 89
gi 2494142    36 HIACCPFHNEKTPSFNVVAKKQFYHCFGCGASGNAISFVMNYLNQGFTDAVETLr 90
gi 81300101   37 FVGLCPFHDDKSPSFTVSPAKQFYYCFSCGAGGNPIKFLMELGKQSFSEVVLDLA 91
gi 339295247  37 LKGLCPFHNEKSPSFHVRPNHGHFHCFGCGEGGDVYAFIQKIEHVSFVEAVELLA 91
gi 16330821   37 HLGLCPFHDEKSPSFSVSPAKQMYYCFGCGAGGNAFNFLMELGKRSFTDVALDLA 91
gi 308183810  33 YMACCPFHEERSASFSVNQIKGFYHCFGCGASGDSIKFVMAFEKLSFVEALEKLA 87
gi 12045104   35 LLALCPFHDDKNPSMSISSSKNIFKCWACNAAGNGIAFIQKHDQLDWKTALKKAI 89
gi 13508092   34 FVALCPFHADQNPSMTVSVAKNIFKCFSCQVGGDGIAFIQKIDQVDWKTALNKAl 88
gi 51474027   34 YVGLCPFHQEKTPSFTVSDSKRFFYCFGCKASGDVIKFTSNISGLSYNESAIKLA 88
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap