1CO4


Conserved Protein Domain Family
Cu_FIST

?
smart00412: Cu_FIST 
Click on image for an interactive view with Cn3D
Copper-Fist
binds DNA only in present of copper or silver
Statistics
?
PSSM-Id: 128690
View PSSM: smart00412
Aligned: 9 rows
Threshold Bit Score: 67.8298
Threshold Setting Gi: 5542205
Created: 12-Jul-2011
Updated: 16-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|
1CO4_A         2 VVINGVKYACDSCIKSHKAAQCEHNDRPLK-ILKPRGRPP 40
gi 256270094   2 VLINGIKYACERCIRGHRVTTCNHTDQPLM-MIKPKGRPS 40
gi 406767      2 IIFNGNKYACASCIRGHRSSTCRHSHRMLI-KVRTRGRPS 40
gi 19113835    2 VVINNVKMACMKCIRGHRSSTCKHNDRELF-PIRPKGRPI 40
gi 50546220    2 VVIEGIKYACERCIRGHRVSSCTHTQQPLI-RIKPKGRPA 40
gi 323304971   2 VVINGVKYACETCIRGHRAAQCTHTDGPLQ-MIRRKGRPS 40
gi 19075723    2 IIIDGKNYACVVCLRGHRGSSCQHQERALI-EVRTRGRPL 40
gi 50289997    2 VVINGVKYACDSCIKSHKAAQCEHNDRPLK-ILKPRGRPP 40
gi 171681972   2 PIINGQKMACGPCIRGHRSTKCNHYNERVMvPVRKPGRPL 41
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap