Conserved Protein Domain Family
SCAN

?
smart00431: SCAN 
leucine rich region
Statistics
?
PSSM-Id: 128708
View PSSM: smart00431
Aligned: 20 rows
Threshold Bit Score: 175.571
Threshold Setting Gi: 74722393
Created: 12-Jul-2011
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11135560    42 REVFRQYFRQFCYQETSGPREALSRLRELCHQWLRPETHTKEQILELLVLEQFLTILPEELQAWVQEQHPESGEEVVTVL 121
gi 11136033    38 WETSHLHFRQLRYHETSGPQEALSRLRELCRRWLRPEARTKAQILELLVLEQFLSILPGEIRTWVQLHHPGSGEEAVALV 117
gi 41018377    46 PETFRQLFRLFCYQEVAGPREALSRLWELCCRWLRPELRTKEQILELLVLEQFLTVLPGEIQARVREQQPESGEEAVVLV 125
gi 30316343    41 SEACRQRFRQFCYGDVHGPHEAFSQLWELCCRWLRPELRTKEQILELLVLEQFLTVLPGEIQGWVREQHPGSGEEAVALV 120
gi 81908403   120 LEAARLRFRCFRYEDAIGPQEALAQLRELCHQWLRPEVHSKEQVLELLVLEQFLGALPPEIQAQVQGQWPGSPEEAAALV 199
gi 74722393    50 QELFRQLFRQLRYHESSGPLETLSRLRELCRWWLRPDVLSKAQILELLVLEQFLSILPGELRVWVQLHNPESGEELWPCW 129
gi 12232587    42 lETSHQNFRRFRYQEAASPREALIRLRELCHQWLRPERRTKEQILELLVLEQFLTVLPGELQSWVRGQRPESGEEAVTLV 121
gi 193786087   46 FETFYQRFRHFQYHEASGPREALSQLRVLCCEWLRPELHTKEQILELLVLEQFLTILPEEFQPWVREHHPESGEEAVAVI 125
gi 31543980    37 pEASHLRFRRFRFQEAAGPREALSRLQELCHGWLRPEMRTKEQILELLVLEQFLTILPQEIQSRVQELHPESGEEAVTLV 116
gi 114660622   42 PELCRQSFRRFCYQEVSGPQEALSQLRQLCRQWLQPELHTKEQILELLVMEQFLTILPPEIQARVRHRCPMSSKEIVTLV 121
                          90       100       110
                  ....*....|....*....|....*....|...
gi 11135560   122 EDLERELDEPGEQVSVHTGEQEMFLQETVRLRK 154
gi 11136033   118 EELQKDLDGPAIQVPVLVKDQDTLQKVVSAPGT 150
gi 41018377   126 EGLQRKPRKHR------QRGSELLSDDEVPLGI 152
gi 30316343   121 EDLQKQPVK--------AWRQDVPSEEAEPEAA 145
gi 81908403   200 DRLRWELDGPRKWVTVQVQGKEVLSEKMEPSSF 232
gi 74722393   130 RSCRGTLMGHPGGTRALPEPRCALDGYRSLRSA 162
gi 12232587   122 EGLQKQPRRPRRWVTVHVHGQEVLSEETVHLGA 154
gi 193786087  126 ENIQRELEERRQQIVACP---DVLPRKMATPGA 155
gi 31543980   117 EDMQRELGRLRQQVTNHGRGTEVLLEEPLPLET 149
gi 114660622  122 EDFHRASKKPKQWVAVCMQGQKVLLEKTGSQlg 154
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap