3H0G


Conserved Protein Domain Family
ZnF_C2C2

?
smart00440: ZnF_C2C2 
Click on image for an interactive view with Cn3D
C2C2 Zinc finger
Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Statistics
?
PSSM-Id: 128717
View PSSM: smart00440
Aligned: 20 rows
Threshold Bit Score: 60.4207
Threshold Setting Gi: 19114147
Created: 12-Jul-2011
Updated: 16-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|
3H0G_I        73 KECPRCHQHEAVFYQTHSRRGDTMMTLIYVCVHCGFAFEE 112
gi 82000860  204 YKCPNCKQRMCTYREVQTRALDEPSTIFCTCKKCGHEFIG 243
gi 81924669   38 LPCPSCQSKNTMPMMIQTRSADEPPLIKYACKNCQKSFNP 77
gi 82011418  157 TPCPNCKSRNTTPMMIQTRAADEPPLVRHACRDCKQHFKP 196
gi 81965173  155 APCPVCRGLNTTPMILQTRASDEEPTVRYVCKDCNKHFSP 194
gi 15224901  338 FKCGRCGQRKCTYYQMQTRSADEPMTTYVTCVNCDNHWKF 377
gi 291387971 261 FTCGKCKKKNCTYTQVQTRSADEPMTTFVVCNECGNRWKF 300
gi 1085870   141 LQCGKCKSRKTSYYEMQTRSADEPMTVFAKCHSCGSRWKQ 180
gi 6322523    84 eKCPQCGNEEMNYHTLQLRSADEGATVFYTCTSCGYKFRt 123
gi 323337605  61 RECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTS 100
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap