2D3J


Conserved Protein Domain Family
WIF

?
smart00469: WIF 
Click on image for an interactive view with Cn3D
Wnt-inhibitory factor-1 like domain
Occurs as extracellular domain in metazoan Ryk receptor tyrosine kinases. C. elegans Ryk is required for cell-cuticle recognition. WIF-1 binds to Wnt and inhibits its activity.
Statistics
?
PSSM-Id: 128745
View PSSM: smart00469
Aligned: 6 rows
Threshold Bit Score: 205.021
Threshold Setting Gi: 4585372
Created: 13-Jul-2011
Updated: 16-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2D3J_A      11 SLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDFrkaqqrMPAIPVNIHSMNFTWQAAGqaeYFYEFLSLRSLDKGIM 90
gi 2143518  47 SVSLYLSEDEVRRLLGLDAELYYVRNDLISHYALSF------NLLVPSETNFLHFTWHAKS---KVEYKLGFQVDNFVAM 117
gi 2133649  21 HLNIFLNLHEVLRLIGVSAELYYVREGAINDYALNF------AVPVPANISDVTFTWQSLVd-hPLPYSINIATSDTEVL 93
gi 4582973  19 NVNMFISKEEMNRTFGVKAELNYIEMGNVSSYSTKF------HYRVMANIDYLSFTWNAVGi---VHYEVYVESDDSSVL 89
gi 4585372  35 SLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDFrkaqqrMPAIPVNIHSMNFTWQAAGqaeYFYEFLSLRSLDKGIM 114
gi 4868137  27 HLNVFLNPVEVMRLLGVSAEVYYVREGHINNYALNF------IVPVPANVKDISFTWQSLAg-rGLPYSINVVSSDQEVL 99
                       90       100       110       120       130       140
               ....*....|....*....|....*....|....*....|....*....|....*....|....*.
2D3J_A      91 ADPTVNVPLLGTVPHKASVVQVGFPCLGKQDgvAAFEVDVIVMNSEG-NTILQTPQNAIFFKTCLQ 155
gi 2143518 118 GMPQVNISAQGEVPRTLSVFRVELSCTGKVD--SEVMILMQLNLTVN-SSKNFTVLNFKRRKMCYK 180
gi 2133649  94 PRPILNISRIGDVPVEPQTWGIALKCSGTRN--AEVTVTINVEVILDrATNNNTNLIFKRKKICLR 157
gi 4582973  90 --PIVRIPLKGTVPESLQDFTVEYRCAGHRS--GQFAVSLYFTFKYG--NKEPLKVKLRQEKICAS 149
gi 4585372 115 ADPTVNVPLLGTVPHKASVVQVGFPCLGKQDgvAAFEVNVIVMNSEG-NTILRTPQNAIFFKTCQQ 179
gi 4868137 100 PRPAINVSHSGEIPTTIQTWSIALKCSGLKA--AEVDVTVSLEVVLNrSLNNVTHLVFRRKKICLM 163
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap