Conserved Protein Domain Family
BBC

?
smart00502: BBC 
B-Box C-terminal domain
Coiled coil region C-terminal to (some) B-Box domains
Statistics
?
PSSM-Id: 128778
View PSSM: smart00502
Aligned: 20 rows
Threshold Bit Score: 103.113
Threshold Setting Gi: 66774189
Created: 12-Jul-2011
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66774189   208 LREKVREHLGELSKQSETIGNALHSIDSVIHELTpgqedGSLEETRQEVRNHFRRLRTALDRDEEDAVETVDRYARNRVE 287
gi 82217561   196 KKEKLGKVLEKLTLEREEAEREVQGLQEDLK--------EKAAGETERVTVLFRDIRKWVDSLEKQMLDVLSRQKEKLSR 267
gi 1488045    183 KKEKLREVLEKLRPERVETVKAAQKLEERRREVA-----EKAAGETERVTALFRDIREQLETLENRLLGDLSSQKEKITL 257
gi 1665803    159 HKSQLSQALNGLSDRAKEAKEFLVQLRNMVQQIQ-----ENSVEFEACLVAQCDALIDALNRRKAQLLARVNKEHEHKLK 233
gi 74964103   280 IREDVTSTVDRVEKKYNNSVADMNSLPDKSQQLN-----EQYEIAKYRVDKHYEELRNSIEEAYQKSVNDLEEARIRQES 354
gi 17558548   320 HKTELSTTLQQLSEKAKTATEEIGRLKGLHDVVK-----NNCNDFKSSLCIQIDQLIEQLQMRKEKLMQHVDEQADNKRR 394
gi 71980713   519 IRVAVGEVVNESQLLQWQCEKTGDTIKQIIDGIV-----TNATTAENEIRAAFDTHVNALEERRKELLKRVETVKNLKLS 593
gi 332226087  246 LKQTLEMNLTNLVKRNSELENQMAKLIQICQQVE-----VNTAMHEAKLMEECDELVEIIQQRKQMIAVKIKETKVMKLR 320
gi 17554338   268 QMLKMEQLIADARSKHADMLDMFKQVDNKQQVLT-----ASLHNAHAQLEETVSNLINVIQDQKKTLAKDIDNAFAAKQI 342
gi 118572616  285 QLIALVSPLETTMKENQKLKCDQSQKISLHRE--------NIVDCKKHIECEFEKLHQFLREKEAKMVEDLNAEREGLLK 356
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|..
gi 66774189   288 SLQTQKERLEAISSKIGNTCTTLQKALIMERGKILDRKDDLLALAESTAAEP 339
gi 82217561   268 DLCDVIQNLEIKQDELSGKIRHIEELCNMADPLVVLQERESHGAAFCGAEAA 319
gi 1488045    258 TLTDLMEQLEIKKNILSRKIRHIEELCNMADPFTIPHEWELDEVSERDDIKV 309
gi 1665803    234 VVRDQISHCTVKLRQTTGLMEYCLEVIKENDPSGFLQISDALIRRVHLTEDQ 285
gi 74964103   355 NIDEMYRKSQVNEARVHDAINFTRRLLTKGNGLELVVSRKKVIQQFGNLSHA 406
gi 17558548   395 ILKSQIVKCTGKLTKTSALIQFCIEALKEPDPTVYMQISNALLHRSTSLEFl 446
gi 71980713   594 VLISQAESLQSKQIDLQQAIQTATKLMDSSDCDEMVLRQVFEKLASCQMGNE 645
gi 332226087  321 KLAQQVANCRQCLERSTVLINQAEHILKENDQARFLQSAKNIAERVAMATAs 372
gi 17554338   343 QLTMVDKRIQSMADKLSQTIEFSRRLMSFASPAEVMVFKQLLDTRLQLFLGF 394
gi 118572616  357 DMEANLVKMTDNCEFIEEAISTTQSRLNESDPIAFLTDIKSFIEKCCEEHRK 408
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap