3PO3,2DME


Conserved Protein Domain Family
TFS2M

?
smart00510: TFS2M 
Click on image for an interactive view with Cn3D
Domain in the central regions of transcription elongation factor S-II (and elsewhere)
Statistics
?
PSSM-Id: 128786
View PSSM: smart00510
Aligned: 18 rows
Threshold Bit Score: 95.8429
Threshold Setting Gi: 7267856
Created: 12-Jul-2011
Updated: 16-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3PO3_S         15 HKLRDQVLKALYDVLAKESEHPp-----------QSIL-------------HTAKAIESEMNKVN-------N---CDTN 60
gi 59800464   215 NPVRKSVAKAWVSVFEKIIEKAkleg----vqglEDLN-------------STSLALQLEHIMFMvlsyttdH---SLTP 274
gi 119595730  708 QNIRRSLKEILWKRVNDSDDLIm-----------TENE-------------VGKIALHIEKEMFN-------L---FQVT 753
gi 15233998   119 DKVREILQTSLAKVASEVVDTEmkt-------rvTACD-------------PWVVAVSVETAMFE-------N---LGCF 168
gi 51968872   290 EFTVNCQNEMIGAMANDGSLEK------------LLLD-------------PQVLAFEIETELFK-------L---FGGV 334
gi 297478338  921 QSVRHSLKDILMKRLTDSNLKVp-----------EE-K-------------AAKVATKIEKELFS-------F---FRDT 965
gi 207345303   79 HKLRDQVLKALYDVLAKESEHPp-----------QSIL-------------HTAKAIESEMNKVN-------N---CDTN 124
gi 19114535   131 DKIRNNCIGLMYNALVIDSDESss---------lIIAK-------------AKEIDAQVLARA-------------AGKT 175
gi 300234     146 HKLRYNAEKMFSTLFSKFIVPEt-----------IEAKlyelpdgkdvisiSQEFAHNLEEELYKacl--nvE---FGTL 209
gi 7267856    428 DAHRDKCLGKLLEAVQHICYIPenkqagdeakdeKFLW-------------PDAAVPQVCALENA-------ShasLASD 487
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*.
3PO3_S         61 EAAYKARYRIIYSNVISKNNPDLKHKIANGDITPEFLATCDAKDLAPAPLKQKIEE 116
gi 59800464   275 NNKYREKFRALRFNLVDDKNPAFRARVLKNEISFNDLVNLSSEEMANPDLKNLAEE 330
gi 119595730  754 DNRYKSKYRSIMFNLKDPKNQGLFHRVLREEISLAKLVRLKPEELVSKELSTWKER 809
gi 15233998   169 MGPQKAKYRSILFNMGDSNNPDLRRKVLLGEISGERLVKMEKEEMGSSWYTNSRRN 224
gi 51968872   335 NKKYKEKGRSLLFNLKDKSNPKLREKVMYGEIAAERLCSMSAEELASKELAEWRQA 390
gi 297478338  966 DAKYKNKYRSLMFNLKDPKNNILFKKVLKGEVTPDHLIRMSPEELASKELAAWRRR 1021
gi 207345303  125 EAAYKARYRIIYSNVISKNNPDLKHKIANGDITPEFLATCDAKDLAPAPLKQKIEE 180
gi 19114535   176 GSEYRNRMRSLYMNLKDKNNPKLRASVLRNEITPQRLSTMTSAELASEDRRKEDAK 231
gi 300234     210 DKIYTEKVRSLYSNLKDKKNLELKAHVVEGKLPLNKLVNMNASELANPDLQEFKEK 265
gi 7267856    488 FQKYNQKMRTLVFNLK--NTALLARRLLNGELEPATILNMSPTEL-KEGLTADETT 540
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap