2WZO


Conserved Protein Domain Family
FYRN

?
smart00541: FYRN 
Click on image for an interactive view with Cn3D
FY-rich domain, N-terminal region
is sometimes closely juxtaposed with the C-terminal region (FYRC), but sometimes is far distant. Unknown function, but occurs frequently in chromatin-associated proteins.
Statistics
?
PSSM-Id: 128814
View PSSM: smart00541
Aligned: 17 rows
Threshold Bit Score: 48.8192
Threshold Setting Gi: 7486758
Created: 12-Jul-2011
Updated: 16-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*.
2WZO_A         19 EIITDRPGFHDESAIYPVGYCSTRIYASMKCPDQKCLY--TCQIKD 62
gi 7488429    643 GFLVVGKLWCNKHAIFPKGFKSRVKFYNVQDPMRISYYv-SEIVDA 687
gi 4926825    611 GFLIFGKLWCNKYAIFPKGFRSRVKFYNVLDPTRMSNYi-SEVLDA 655
gi 4582458    393 KVVTDSQFFKDENHIWPEGYTAMRKFTSLTDHSASALYk-MEVLRD 437
gi 7507727   2149 ITPKQLKRFHTKDYIFPNNYRITRLFWSPKSHRERMMF--ECIIED 2192
gi 7486758    647 VHGITDKSAVTDVKLGVGGFKSRVKFLSVLDPTNLTNYi-SEVLDA 691
gi 7301257    122 EIISVNPNFHTESWIYPVGYVATRIYAHPKDPRKKCVF--TCKILN 165
gi 224083075 1894 CLGILNDLSDCEDKLFPIGYQCSRVYWSTTDARKRCVY--TCKIME 1937
gi 297276803 1861 sLGTLSDLSDCEGRLFPIGYQCSRLYWSTVDARRRCWY--RCRILE 1904
gi 195392284 1890 LGSIVPRFSDSFEAIVPINFLCSRLYWSSKEPWKIVEYtvRTTIQN 1935
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap