Conserved Protein Domain Family
FTP

?
smart00607: FTP 
eel-Fucolectin Tachylectin-4 Pentaxrin-1 Domain
Statistics
?
PSSM-Id: 128870
View PSSM: smart00607
Aligned: 10 rows
Threshold Bit Score: 202.402
Threshold Setting Gi: 74871592
Created: 12-Jul-2011
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82174584   29 QENVAVRGKATQSTLPSGAGAVLSLPGFAIDGNRDSDFSHG-SCSHTTNSpNPWWRVDLLQLYTITSVTITNRGDCCGER 107
gi 82174581   31 EENVALRGRATQSAQLRGEHAALAHASNAIDGNRDSNYHHG-SCTHTEGA-NPWWRVDLLQVYTIASVTITNRGDCCGER 108
gi 74871730  113 GVNVAYRKPVNQSSYTRSGP-----ASYANDGKPGNKNPDGqECSETQKEpSPWWRVDLLTPQAVHVVRITTRGCCGHQP 187
gi 1346926    37 AKNVAPQGIPYQSSY----YGQKEQAKRVIDGSLASNYMEG-DCCHTEKQmHPWWQLDMKSKMRVHSVAITNRGDCCRER 111
gi 82174580   40 QENVAVRGKATQSALASGGGAVLSLPGYAIDGNRDSDSSHG-SCSHTTNGpNPWWRVDLLQVYTIASVTITNRGDCCGER 118
gi 82174579   40 QENVAVRGKATQSDQLQGQWDAFSHASNAIDGNQDSYFYHG-SCTHTSGGaNPWWRVDLLQEYKITSVTITNRGDCCGER 118
gi 82174578   40 QENVALRGRATQSAQLRGDHSGIAHASNAIDGNRDSVFYHG-SCTHTEAD-KPWWRVDLLQVYTITSVTITNRGDCCEER 117
gi 82174582   31 QENVALRGRATQSAQLKGEFAGFAHASNAIDGNRDSNYHHG-SCSHTEGD-NSWWRVDLKQVYTITSVTITNRGDCCGER 108
gi 82174583   31 QENVALRGRATQSAQLRGEHAGISHASNAIDGNRDSYFYHG-SCSHTEGD-NPLWRVDLLQVYTITSVTITNRGDCCGER 108
gi 74871592   94 LNVAAGKAPMQISTDGAGA-P----QKAIDGSTSAFFTPET-CSLTKAERsPWWYVNLLEPYMVQLVRLDFGKSCCGNKP 167
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 82174584  108 ISGARILIGNSLENNGINNPACSVIGSMETGETRTFHCPQPMIGRYVTVYLPK-T-EVLQLCEVE--VNALLPVN 178
gi 82174581  109 ISGARILIGNSLENNGINNPQCSVIGSLATGETRTFHCPQPMIGRYVTVYLPK-I-ESLQLCEVE--VNALLPVN 179
gi 74871730  188 LQDLEIRVGNSSADLQRNPLCAWYPGTLDEGVVKTFTCARPLVGQYVAIQLVG-VeGSLSLCEVEtfTNDEFSVD 261
gi 1346926   112 INGAEIRIGNSKKEGGLNSTRCGVVFKMNYEETLSFNCKE-LEGRYVTVTIPD-RiEYLTLCEVQ--VFA-DPLE 181
gi 82174580  119 ITGAHILIGNSLENNGINNPQCSTVGIMTAGETRTFHCSRPMIGRYVTVYLPK-T-EYLQLCEVE--VNALLPAN 189
gi 82174579  119 ITGARIIIG---KNNGLNNPECSTVGIMTAGETKTFRCSHPMIGRYVTVYLPK-T-EYLHLCEVE--VNAMLPAN 186
gi 82174578  118 ISGARILIGKHLENNGINNPQCSVIGPMAAGETKTFRCPQPMIGRYVTVYLPK-A-ESLHLCEVE--VNVLFPAP 188
gi 82174582  109 ISGARILIGKHLENNGINNPECSTINIMAAGETKTFHCPQPMIGRYVTVYLPK-A-ESLQLCEVE--VNVLFPAP 179
gi 82174583  109 ISGARILIGKHLENNGINNPECSTINIMAAGETRTFHCPQPMIGRYVTVYLPK-T-GTLHLCEVE--VNVLFPAP 179
gi 74871592  168 ATIVVRVGNNRPDLGTNPICNRFTGLLEAGQPLFLPCNPPMPGAFVSVHLENStPnPLSICEAFVytDQALPIER 242
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap