Conserved Protein Domain Family
DM11

?
smart00675: DM11 
Domains in hypothetical proteins in Drosophila including 2 in CG15241 and CG9329.
Statistics
?
PSSM-Id: 128920
View PSSM: smart00675
Aligned: 8 rows
Threshold Bit Score: 221.563
Threshold Setting Gi: 24642685
Created: 12-Jul-2011
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 223556038  16 ADYELLLEDPDIFSPCTEPP-PGSIGFHDAF-DIGDLVVDQ--DMDIIHLSESVTSIW-DVEPTDRISARFAIMHYNRGS 90
gi 45552481   17 TDYELLLEDPDIFSTCTDGP-PGSINIRQAL-NLDDIVIDQ--KGDILHVSGNATVVW-DVQPTDRITARLDVFHFNRGT 91
gi 45552427   18 TDYTLEFEDSDLYSECSEKL-PGAIGLREAF-DMRNIVTEL--DIDGLHLSGNCTTIW-DVPSTDRISLRMTVMHFDRGT 92
gi 242118028  20 TDYNALIDDEGIYVKCSEAP-AGTLGPRDVF-NIDNMVMHM--EPEGIYVSGNMTVKL-NFLPSDRISARFSVMHYERGS 94
gi 78709085   24 MSHDFVPIKDDLLSKCEDK--PEMGYLDAFV-DLSNFSRKR--GPGGVNISGNITTIW-DVDPSDVVEIDVSILKFEGDK 97
gi 45552485   20 TEYQLTLDKDGLLAPCENQ--PGNPSGFEAMvDTSSLKVHN--LGSKVRIEGEQKVVWkDVQPGDTLKVFGQVYRLDKGT 95
gi 281365284  18 TDYILLVEDPDIYTPCTDGP-PGSVGLNEAF-D-----------------------------------ARMSVLHFNRGN 60
gi 24642685   41 TTYEILGDDRILDIVCDAAEdRGNTPIRQIL-DISGLTVDMaaDLETLYFNGDIKVLI-DV-PNNPMAMEVDVFRWERSE 117
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 223556038  91 WEPTVFSMATPDFCASMFDENQSWFKYWTKHISNRDEVMEKCFKTRGTVIMHNPFDLQLRLTDIRGATLRGRYKAVVTFE 170
gi 45552481   92 WEPTVFSMATQNFCSIMYDKNQYWYKYWTRFITNRHEVEKKCFRGPDTVLVHEPFDLILKFENFRGPLLRGRHKLVILFN 171
gi 45552427   93 WQPTVFNTYARDFCAVMFDKELSWYKYWLKYFANREEISEKCIGTKGTVLVYKPFIVKPLIQNVIGPIYRGRVKAIFNFE 172
gi 242118028  95 WQPTMFNLHSPNFCEVMFDEDQYWFKYWFRYIRNKEEIREKCLKVKDTVLVYDEFLMVLHLENVNTSNLQGRYKAVITLE 174
gi 78709085   98 WIPTIIKGNVKDFCKSFYDKNTLYYSYSTKHVVNKKEAKEKCITTPGAILLWEPYLLKISFS-YAVPLNVGRHKAVLIFT 176
gi 45552485   96 WQKTMFTASSNNFCKNMFDKNQYWYNFWTKYISNSDEIKEKCLTTPGAVLKYKDYELDLKTS-LNVPNLDGRYKLVVQIE 174
gi 281365284  61 WEPTVFNTLTPDFCDAMFNPNLFWYKYWFKNFENREEIQEKCLATQGTVLVYNPFVVVPRLNNVLGPTLKGRYKVVFLFE 140
gi 24642685  118 WIPTTLAMKRDSFCMSLSNPMELWYPIFLKVP--KEE--MICPPKKGHVYRLANVSNHVFVRNMPYANIAGDAKAVVHLT 193

                 ....*....
gi 223556038 171 AVDEKDVPR 179
gi 45552481  172 ALDERNIPR 180
gi 45552427  173 SFDKNNVKG 181
gi 242118028 175 AFDEHNVRR 183
gi 78709085  177 AIDKAGVKR 185
gi 45552485  175 AFDKRNVRR 183
gi 281365284 141 AFNEQDERQ 149
gi 24642685  194 SGDIKTCAV 202
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap