Conserved Protein Domain Family
DM13

?
smart00686: DM13 
Domain present in fly proteins (CG14681, CG12492, CG6217), worm H06A10.1 and Arabidopsis thaliana MBG8.9.
Statistics
?
PSSM-Id: 128929
View PSSM: smart00686
Aligned: 9 rows
Threshold Bit Score: 128.629
Threshold Setting Gi: 15239759
Created: 12-Jul-2011
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17568459  157 FGEYGIISDPIEVIDSRTLKIPKFSYKaSQTPDGYFFAGAGSEIDQKs--GKKaailRS--DQTLn--YCPMLKDIT--D 228
gi 221458788 211 RLAHGLRSSNISVLDAKTFYIPNLHYD-GAGPDAYFWVGNGSEPNIM---GIK----VP--NESG---SLEPLRGYQ--G 275
gi 78706736  158 RGVHGVSSDNIVIVDAQTLLVPNFSYD-GEAPDAKFWVGRGQRPTSD---GLR----IP--DENG---KENPLRRYE--R 222
gi 78706736   42 RLHHGVSGD-VYAVDSRTIFIKKFNYD-GEAPAAYFYVGNTARPSNEg--AAR----LR--DERGg--TASLTRRYR--N 107
gi 195572053 166 KRSHNVSSSSVEILDSKTIRIKDFTYD-GRGKRTFFWTGVGPQPSSR---GSK----LP--DERG---YLDPIRQYN--K 230
gi 195330163  51 SYHHQVSGD-VYAVNEYTFLIVGFNYD-GNGADTFFWSGASNRPGPQ---GFI----VP--DEYG---KTNILDRYH--N 114
gi 7508764    38 SSPETDISGQVFIVNATTLQIFNLTFS-PSQQDLYFWLDTKDVPTREg--IKA----HT--FEYG----ITPLGSFPedN 104
gi 193210429 736 SLQFNISSGPIEILDVKTIRINDFSFQ-H-DDDSVWLMVGSELLPNLn--GKI----VPlfDENTrkfDCQGLMSYH--G 805
gi 15239759   42 MLQHQLRGV-FTVVDDCSFRVSRFDML--SGSEVHWWGAMSSDFDNMtndGFV----IS--DQK-------LNQTFK--N 103
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|..
gi 17568459  229 QDIIIRLDQSQTIYDIEWISVFCYKYSHDFGHLDMGLVENEE 270
gi 221458788 276 EDIEIQLPESLTVYDIDWLAVWCVEYRHNFGHVYIPRDLDVP 317
gi 78706736  223 KTIVLTLPEDLTIFDIGHFGVWCEAFTVDFGHVRLPEGLNVP 264
gi 78706736  108 KDVTLSLPEGKTLRDIKWFSVWCDEFAVNFGDVSIPPNLDFP 149
gi 195572053 231 ETIELELPGDKTIFDIDWISVYDVADNENYGHVLFNDKLNVP 272
gi 195330163 115 KDFTLTLPDRKKITEIKWLAVYDLSSQNNFGDVYIPEEFDPP 156
gi 7508764   105 DRVVVHVPEKHRIDEFKSFSIYSFKTDKSMASVVFPENVKIP 146
gi 193210429 806 ETIVFRLPGELTWKDVFWFSSHLC-LILNGDSFLFLKKFKIS 846
gi 15239759  104 SSFIVRLLGNVTWDKLGVVSVWDLPTASDFGHVLLSNATESD 145
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap