Conserved Protein Domain Family
Citrate_ly_lig

?
smart00764: Citrate_ly_lig 
Citrate lyase ligase C-terminal domain
Proteins of this family contain the C-terminal domain of citrate lyase ligase EC:6.2.1.22.
Statistics
?
PSSM-Id: 129003
View PSSM: smart00764
Aligned: 20 rows
Threshold Bit Score: 293.767
Threshold Setting Gi: 42527030
Created: 12-Jul-2011
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50121498 157 IGAIVMNANPFTLGHRYLAEHAAQSCDWLHVFVVREDVSFFPFSERLEMVQRGVEHIHNLTVHAGSNYMISKATFPAYFL 236
gi 19703664 144 IASLIMNANPFTLGHQYLVEKASSENDVLHLFIVSDDSSLVPFEVRKKLVIEGTKYLKNICYHETGDYIISSATFPSYFQ 223
gi 58337217 151 IAAIVMNANPFTLGHKHLVKMASEENDLVYVFVVANDVSLFNFDERMKLVKEGTKEFDNVKIVSGGDYMVSPATFPAYFL 230
gi 18253277 148 tAALVINANPFTLGHQYLVEKAAAENELLHLFMVSDDSSLIPFSVRKQLILAGTEHLSNICYHETGPYIISKSIFPSYFQ 227
gi 6249491  149 KASIVMNANPFTLGHRYLVEQASKENDHVYIFVVNQDVSLFTIAERFNLVKQGVVDLDNVDVINGQEYMVSYLSFSSYFI 228
gi 28212136 150 KTALVMNCNPFTLGHRYLIEHASKNSKEVIVFIVEEDKSLFPFKTRYNLVKEGTKDLKNVKIVPGGEYIISSATFPTYFI 229
gi 94988642 147 VAAIVINANPFTLGHQFLVEKAARENDWVHLFMVSEDQSLVPFSVRKMLIQEGLRHLDNIIFHETGPYLISQATFPAYFQ 226
gi 15673170 144 IAAVVMNANPFTLGHCYLVEQAAAENDFVYVFVVSTDRSLFRADERLDLVKKGLSALTNVSVVSGGDYLVSFATFPAYFI 223
gi 29377763 146 aSSIVMNANPFTKGHQYLVEKAAQESPHVYVFVLSEDKSLFSKEARFAMVQKGVAHLPNVTVLSTEDYLVSSATFPTYFL 225
gi 5921790  136 VASVVINANPFTNGHRFLIEEASRNNELVYVFVLNQEASLFHTDERIALVKAGVQDLSNVIVVNGGAYIISYLTFPAYFL 215
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 50121498 237 KEEK--LITRAHAALDLIIFRKYIAPALGITQRFVGTEPFCPVTYQYNQDMhywlekDQTVSSPALNVVEIERKrQT--S 312
gi 19703664 224 KDEV--AVIESQANLDIEVFTK-IAKVLNINKRYVGEEPNSLVTNIYNQTM------VKKLPENNIECVVVPRK-KY--S 291
gi 58337217 231 KSSD--DLIDVQTAIDASVFKNKIAPALNITRRYIGKEPISRTTHFYNVSL-------AHELGPDIEVIVVKRL-EK--D 298
gi 18253277 228 KDQA--SVIESQARIDLAIFIQ-IAKYLGIKGRYVGEEPTSLVTGIYNQIM------LQELPKKAIDCIVVPRK-TY--K 295
gi 6249491  229 KNAD--DVIKYQTTLDARLFRDGIAKPLNITKRYVGTEPLSHTTAIYNETL-------QTELQPSVQLIEIDRK-QFe-M 297
gi 28212136 230 REED--ILVKAHAEIDAGIFGKYFGEKFNIKKRYVGEEPYCEVTNAYNQVL------KSTLPKFGIELEEIKRK-EI--Q 298
gi 94988642 227 TEDN--DVIKSQALLDTAIFLK-IAQTLQITKRYVGEEPTSRVTAIYNEIM------AEQLQQAGILLDILPRK-AI--N 294
gi 15673170 224 QSDE--EVMDFQTQIDARIFKNWFVEALGITTRYLGAEPFSKTTSIYNQQL------T-EVLSDVIDVKIIERK-KAddN 293
gi 29377763 226 KEKAplEVAAIQATLDATLFKERIAPILEIQQRYVGEEPYSEVTAVYNQAM-------QQVFGQTITLTIVPRL-AS--D 295
gi 5921790  216 KHND--SAIDYQTTIDVRLFKYKIASALGITSRYVGSEPLSHTTNLYNQKL-------ISELNPQIEVHVIQRK-LA--A 283
                       170       180       190
                ....*....|....*....|....*....|....*
gi 50121498 313 GL--AISASEVRKLLKLRQYSRIQDIVPASTFEHL 345
gi 19703664 292 DN--VISASTVRQIIKNGNLEDLKNLVPETTYNYF 324
gi 58337217 299 GE--IVTATKVRQLIKDGNLKEIDKFVPESTYLFI 331
gi 18253277 296 DG--PISASTVRKALKEGNEQILRELLPSTSLNYF 328
gi 6249491  298 TH--VISATTVRSAIERGDEMLYQQLVPPTTKQFI 330
gi 28212136 299 GD--FISASKVRGLIREGKLDEIINLVPSVTWEFL 331
gi 94988642 295 QQqdPISASTARQALKDNDWDLLAKLLPKTSLDYF 329
gi 15673170 294 EE--IISATAVRAAIATNQLEKIRNFVPETTFEFI 326
gi 29377763 296 GE--LISATKVRKAMAEGDKETLKKFLPATSYQYL 328
gi 5921790  284 GDlgVISARTVREAIDKGDEAVWQKMVTETTQHFI 318
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap