Conserved Protein Domain Family
PhnA_Zn_Ribbon

?
smart00782: PhnA_Zn_Ribbon 
PhnA Zinc-Ribbon
This protein family includes an uncharacterised member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterised phosphonoacetate hydrolase designated PhnA.
Statistics
?
PSSM-Id: 129018
View PSSM: smart00782
Aligned: 7 rows
Threshold Bit Score: 81.0039
Threshold Setting Gi: 24373151
Created: 12-Jul-2011
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40
                ....*....|....*....|....*....|....*....|....*..
gi 71278202   6 ALKNRSNNSCELCTSTDTLVVYPVPPTSDLSAQQSIYLCQNCLSQID 52
gi 59713766   6 TLLTRCDSKCELCGSTNSLAPFAVPPKTDITVDNCVMICDTCTAQIE 52
gi 28900713   6 TLLARCESKCELCSSESPLTAYAVPPHGNVTVDTAIMVCDKCHSEIE 52
gi 15601308   9 TLLERCQSQCELCAASTPLSPFVVAPHALVTVDHAVMLCDTCKGQIE 55
gi 54302369   6 ALKQRSDSKCELCASDSNLTVHAVAASPDSSAGNCVLLCETCHSQIE 52
gi 51245739   6 ELYARSESKCELCNAIENLVVFAVPPESAANADKSVLICSHCAEQIE 52
gi 24373151   5 ELLTRCGGKCELCGSDVELAIYDLPASDGH--ENEIMICENCSSQIA 49
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap