Conserved Protein Domain Family
TAF

?
smart00803: TAF 
TATA box binding protein associated factor
TAFs (TATA box binding protein associated factors) are part of the transcription initiation factor TFIID multimeric protein complex. TFIID is composed of the TATA box binding protein (TBP) and a number of TAFs. The TAFs provide binding sites for many different transcriptional activators and co-activators that modulate transcription initiation by Pol II. TAF proteins adopt a histone-like fold.
Statistics
?
PSSM-Id: 129039
View PSSM: smart00803
Aligned: 28 rows
Threshold Bit Score: 57.63
Threshold Setting Gi: 71026272
Created: 12-Jul-2011
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 123479321   2 AKAKQETLRTIFKSLGLGvDNEASIMYTLVDHAQTRILNILGNALQITHKCKRNRLTVNDINIALE 67
gi 332866939  49 TVLPSESMKVVAESMGIA-QIQEETCQLLTDEVSYRIKEIAQDALKFMHMGKRQKLTTSDIDYALK 113
gi 333468721  11 STLSLESIKVIAESIGVG-SLPDDAAKELADDVSYKLKQIVQDAVKFMHHSKRMKLSIADVDHSLK 75
gi 11991529   12 TLFPTESMKVIAESIGIS-QVPEETCQLLTEEVSYRIKEITQDALKFMSVGKRQKLTTCDIDSALR 76
gi 148233408  10 TLLPSESMKVISESVGIS-QMSEETCQLLAQEVSFRIKEVTQDALKFMHVGKRQKLTPSDIDAALK 74
gi 148235636  10 VELCQDSVRLTAESVGLD--ITDEVAALLAEDVCYRLRELTQFSAQGLRHSRRRRLTVEDFNRALR 73
gi 195173306  19 SVYSAESIKVIAESIGVG-TLSDDAAKELGEDISIKLKRIVQDAAKFSNHAKRQKILISDIDMSLK 83
gi 67468804    4 QKIPLDFIKSMLSANGFE-EMSDEMINLISEEAENSISELFNEATKFMRHSKRKILTIQDINSALK 68
gi 47209819   10 AEVSRESVRLMAESAGV--ELDDDVAALLAEDS----------SSQFMRHAKRRKLTVEDFNRALR 63
gi 7509154   258 ahqtpiftQTAAEMLGIT-SLNTEAAELLEFLSREKLKEIVRLSAKWTQKSARRRMAVADVEHAIR 322
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap