1AVA,2QPU


Conserved Protein Domain Family
Alpha-amyl_C2

?
smart00810: Alpha-amyl_C2 
Click on image for an interactive view with Cn3D
Alpha-amylase C-terminal beta-sheet domain
This entry represents the beta-sheet domain that is found in several alpha-amylases, usually at the C-terminus. This domain is organised as a five-stranded anti-parallel beta-sheet.
Statistics
?
PSSM-Id: 129046
View PSSM: smart00810
Aligned: 27 rows
Threshold Bit Score: 93.509
Threshold Setting Gi: 52851182
Created: 12-Jul-2011
Updated: 16-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
1AVA_A       342 TRHGIHNESKLQIIEADADLYLAEIDGKVIVKLGPRYDVGNLIPGG--FKVAAHGNDYAVWEK 402
gi 18416465  362 NKNGIGSTSSVTIKAAEADLYLAMIDDKVIMKIGPKQDVGTLVPSN--FALAYSGLDFAVWEK 422
gi 1220451   287 KRNRICATSNVQIMASDSDLYIAMIHHKIIVKIGPKLDLGNLIPPN--YEVATSGQDYAVWEQ 347
gi 60652321  834 NRNKIHCRSTIQITKAERDVYAAIIDKKVAMKIGPGFYEPASGPQR--WSLAVEGNDYKVWEA 894
gi 12325228  765 NRQKLHCRSEVNIDKSERDVYAAIIDEKVAMKIGPGHYEPPNGSQN--WSVAVEGRDYKVWEt 825
gi 60652317  840 NRNKLNCRSRVKITKAERDVYAAIIDEKVAIKIGPGHYEPASGPQN--WNKSLEGRDYKVWEA 900
gi 115458194 386 KCQDIHSRSAVKILEASSDLYSAIVDDKLCMKIGD----GSWCPSGpeWKLAASGDRYAVWHK 444
gi 6573706   354 RRQDIHSRSTVRVLKAESNLYAAIVGEKICMKLGD----GSWCPSGrdWTLATSGHRYAVWHK 412
gi 7532799   355 KRQDIHSRSSITILEAQPNLYSAMIGEKVCMKIGD----GSWCPAGreWTLATCGHRYAVWNK 413
gi 52851182  355 KHQGIHSRSSIHIIEAQPNLYAANIGDKVSMKIGD----GSWCPSGkeWTLATSGHRYAVWQK 413
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap