NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|5542178|pdb|1CGQ|B]
View 

Chain B, Macrophage Migration Inhibitory Factor (Mif) With Alanine Inserted Between Pro-1 And Met-2

Protein Classification

MIF domain-containing protein (domain architecture ID 10471872)

MIF domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
MIF pfam01187
Macrophage migration inhibitory factor (MIF);
3-115 2.56e-66

Macrophage migration inhibitory factor (MIF);


:

Pssm-ID: 250427  Cd Length: 114  Bit Score: 195.35  E-value: 2.56e-66
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1CGQ_B          3 MFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCG 82
Cdd:pfam01187   2 MFTIDTNLPANSVPAGLEKRLTAALAKALGKPADRIAVHIRPGQAMVFGGSTDPCAVCSIKSIGVVGAEQNRSHSALLFK 81
                          90       100       110
                  ....*....|....*....|....*....|...
1CGQ_B         83 LLAERLRISPDRVYINYYDMNAANVGWNNSTFA 115
Cdd:pfam01187  82 FLTKELGLPKDRIYIRFFDLEAAQVGFNGTTFA 114
 
Name Accession Description Interval E-value
MIF pfam01187
Macrophage migration inhibitory factor (MIF);
3-115 2.56e-66

Macrophage migration inhibitory factor (MIF);


Pssm-ID: 250427  Cd Length: 114  Bit Score: 195.35  E-value: 2.56e-66
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1CGQ_B          3 MFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCG 82
Cdd:pfam01187   2 MFTIDTNLPANSVPAGLEKRLTAALAKALGKPADRIAVHIRPGQAMVFGGSTDPCAVCSIKSIGVVGAEQNRSHSALLFK 81
                          90       100       110
                  ....*....|....*....|....*....|...
1CGQ_B         83 LLAERLRISPDRVYINYYDMNAANVGWNNSTFA 115
Cdd:pfam01187  82 FLTKELGLPKDRIYIRFFDLEAAQVGFNGTTFA 114
PTZ00397 PTZ00397
macrophage migration inhibition factor-like protein; Provisional
2-114 1.75e-22

macrophage migration inhibition factor-like protein; Provisional


Pssm-ID: 240401  Cd Length: 116  Bit Score: 84.49  E-value: 1.75e-22
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1CGQ_B         2 AMFIVNTNVPRASVpDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLC 81
Cdd:PTZ00397   4 CQVSTNVNATDDQA-DAALSDIENAIADVLGKPLSYIMSGYDYQKHMRFGGSHDGCCFVRVTSIGGISRSNNSSIAAAIT 82
                         90       100       110
                 ....*....|....*....|....*....|...
1CGQ_B        82 GLLAERLRISPDRVYINYYDMNAANVGWNNSTF 114
Cdd:PTZ00397  83 KILASHLKVKSERVYIEFKDCSAQNWAFNGSTF 115
 
Name Accession Description Interval E-value
MIF pfam01187
Macrophage migration inhibitory factor (MIF);
3-115 2.56e-66

Macrophage migration inhibitory factor (MIF);


Pssm-ID: 250427  Cd Length: 114  Bit Score: 195.35  E-value: 2.56e-66
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1CGQ_B          3 MFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCG 82
Cdd:pfam01187   2 MFTIDTNLPANSVPAGLEKRLTAALAKALGKPADRIAVHIRPGQAMVFGGSTDPCAVCSIKSIGVVGAEQNRSHSALLFK 81
                          90       100       110
                  ....*....|....*....|....*....|...
1CGQ_B         83 LLAERLRISPDRVYINYYDMNAANVGWNNSTFA 115
Cdd:pfam01187  82 FLTKELGLPKDRIYIRFFDLEAAQVGFNGTTFA 114
PTZ00397 PTZ00397
macrophage migration inhibition factor-like protein; Provisional
2-114 1.75e-22

macrophage migration inhibition factor-like protein; Provisional


Pssm-ID: 240401  Cd Length: 116  Bit Score: 84.49  E-value: 1.75e-22
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1CGQ_B         2 AMFIVNTNVPRASVpDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLC 81
Cdd:PTZ00397   4 CQVSTNVNATDDQA-DAALSDIENAIADVLGKPLSYIMSGYDYQKHMRFGGSHDGCCFVRVTSIGGISRSNNSSIAAAIT 82
                         90       100       110
                 ....*....|....*....|....*....|...
1CGQ_B        82 GLLAERLRISPDRVYINYYDMNAANVGWNNSTF 114
Cdd:PTZ00397  83 KILASHLKVKSERVYIEFKDCSAQNWAFNGSTF 115
PTZ00450 PTZ00450
macrophage migration inhibitory factor-like protein; Provisional
32-114 8.94e-06

macrophage migration inhibitory factor-like protein; Provisional


Pssm-ID: 185629  Cd Length: 113  Bit Score: 41.16  E-value: 8.94e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1CGQ_B        32 GKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYdmNAANVGWNN 111
Cdd:PTZ00450  33 GKPEDFVMTAFSDSTPMSFQGSTAPAAYVRVEAWGEYAPSKPKMMTPRITAAITKECGIPAERIYVFYY--STKHCGWNG 110

                 ...
1CGQ_B       112 STF 114
Cdd:PTZ00450 111 TNF 113
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH