NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|20150827|pdb|1KJ2|A]
View 

Chain A, KB5-C20 T-Cell receptor alpha-chain

Protein Classification

immunoglobulin domain-containing protein (domain architecture ID 12207553)

immunoglobulin (Ig) domain-containing protein adopts a fold comprised of a sandwich of two beta sheets and may function in cell adhesion and pattern recognition

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
IgV_TCR_alpha cd04983
Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar ...
3-109 6.34e-49

Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar proteins. IgV_TCR_alpha: immunoglobulin (Ig) variable domain of the alpha chain of alpha/beta T-cell antigen receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are composed of alpha and beta, or gamma and delta, polypeptide chains with variable (V) and constant (C) regions. This group represents the variable domain of the alpha chain of TCRs and also includes the variable domain of delta chains of TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. The variable domain of TCRs is responsible for antigen recognition, and is located at the N-terminus of the receptor. Gamma/delta TCRs recognize intact protein antigens; they recognize proteins antigens directly and without antigen processing, and MHC independently of the bound peptide.


:

Pssm-ID: 319287  Cd Length: 109  Bit Score: 150.88  E-value: 6.34e-49
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1KJ2_A        3 VRQSPQSLTVWEGETAILNCSYEDSTFNYFPWYQQFPGEGPALLISIRSVSDKKEDGRFTIFFNKREKKLSLHITDSQPG 82
Cdd:cd04983   1 VTQSPQSLSVQEGENVTLNCNYSTSTFPYLFWYRQYPGQGPEFLLYISSNGEEKEKGRFSATLDKSRKSSSLHITAAQLS 80
                        90       100
                ....*....|....*....|....*...
1KJ2_A       83 DSATYFCAAR-YQGGRALIFGTGTTVSV 109
Cdd:cd04983  81 DSAVYYCALSeSSGTGKLTFGQGTRLTV 108
 
Name Accession Description Interval E-value
IgV_TCR_alpha cd04983
Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar ...
3-109 6.34e-49

Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar proteins. IgV_TCR_alpha: immunoglobulin (Ig) variable domain of the alpha chain of alpha/beta T-cell antigen receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are composed of alpha and beta, or gamma and delta, polypeptide chains with variable (V) and constant (C) regions. This group represents the variable domain of the alpha chain of TCRs and also includes the variable domain of delta chains of TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. The variable domain of TCRs is responsible for antigen recognition, and is located at the N-terminus of the receptor. Gamma/delta TCRs recognize intact protein antigens; they recognize proteins antigens directly and without antigen processing, and MHC independently of the bound peptide.


Pssm-ID: 319287  Cd Length: 109  Bit Score: 150.88  E-value: 6.34e-49
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1KJ2_A        3 VRQSPQSLTVWEGETAILNCSYEDSTFNYFPWYQQFPGEGPALLISIRSVSDKKEDGRFTIFFNKREKKLSLHITDSQPG 82
Cdd:cd04983   1 VTQSPQSLSVQEGENVTLNCNYSTSTFPYLFWYRQYPGQGPEFLLYISSNGEEKEKGRFSATLDKSRKSSSLHITAAQLS 80
                        90       100
                ....*....|....*....|....*...
1KJ2_A       83 DSATYFCAAR-YQGGRALIFGTGTTVSV 109
Cdd:cd04983  81 DSAVYYCALSeSSGTGKLTFGQGTRLTV 108
V-set pfam07686
Immunoglobulin V-set domain. This domain is found in antibodies as well as neural protein P0 ...
5-109 6.97e-21

Immunoglobulin V-set domain. This domain is found in antibodies as well as neural protein P0 and CTL4 amongst others.


Pssm-ID: 369466  Cd Length: 109  Bit Score: 80.20  E-value: 6.97e-21
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1KJ2_A          5 QSPQSLTVWEGETAILNCSY---EDSTFNYFPWYQQFPGEGPALLISIRSVSDK--KEDGRFTIFFNKREKKLSLHITDS 79
Cdd:pfam07686   1 QTPREVTVALGGSVTLPCTFsssMSSGSLSVYWYRQPPGKGPEFLIAYYSNGSNegKKKGRFSLRGDPSNSDGSLTIQNL 80
                          90       100       110
                  ....*....|....*....|....*....|
1KJ2_A         80 QPGDSATYFCAARYQGgrALIFGTGTTVSV 109
Cdd:pfam07686  81 TPSDSGTYTCAVIPNG--IVVFGKGTRLTV 108
IG smart00409
Immunoglobulin;
7-109 1.50e-14

Immunoglobulin;


Pssm-ID: 214652  Cd Length: 85  Bit Score: 63.29  E-value: 1.50e-14
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1KJ2_A           7 PQSLTVWEGETAILNCSYEDSTFNYFPWYQQfpgeGPALLIsirsvsdkkEDGRFTIFFNKRekKLSLHITDSQPGDSAT 86
Cdd:smart00409   1 PPSVTVKEGESVTLSCEASGSPPPEVTWYKQ----GGKLLA---------ESGRFSVSRSGS--TSTLTISNVTPEDSGT 65
                           90       100
                   ....*....|....*....|...
1KJ2_A          87 YFCAARYQGGraLIFGtGTTVSV 109
Cdd:smart00409  66 YTCAATNSSG--SASS-GTTLTV 85
 
Name Accession Description Interval E-value
IgV_TCR_alpha cd04983
Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar ...
3-109 6.34e-49

Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar proteins. IgV_TCR_alpha: immunoglobulin (Ig) variable domain of the alpha chain of alpha/beta T-cell antigen receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are composed of alpha and beta, or gamma and delta, polypeptide chains with variable (V) and constant (C) regions. This group represents the variable domain of the alpha chain of TCRs and also includes the variable domain of delta chains of TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. The variable domain of TCRs is responsible for antigen recognition, and is located at the N-terminus of the receptor. Gamma/delta TCRs recognize intact protein antigens; they recognize proteins antigens directly and without antigen processing, and MHC independently of the bound peptide.


Pssm-ID: 319287  Cd Length: 109  Bit Score: 150.88  E-value: 6.34e-49
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1KJ2_A        3 VRQSPQSLTVWEGETAILNCSYEDSTFNYFPWYQQFPGEGPALLISIRSVSDKKEDGRFTIFFNKREKKLSLHITDSQPG 82
Cdd:cd04983   1 VTQSPQSLSVQEGENVTLNCNYSTSTFPYLFWYRQYPGQGPEFLLYISSNGEEKEKGRFSATLDKSRKSSSLHITAAQLS 80
                        90       100
                ....*....|....*....|....*...
1KJ2_A       83 DSATYFCAAR-YQGGRALIFGTGTTVSV 109
Cdd:cd04983  81 DSAVYYCALSeSSGTGKLTFGQGTRLTV 108
IgV cd00099
Immunoglobulin variable domain (IgV). IgV: Immunoglobulin variable domain (IgV). Members of ...
10-109 9.79e-23

Immunoglobulin variable domain (IgV). IgV: Immunoglobulin variable domain (IgV). Members of the IgV family are components of immunoglobulin (Ig) and T cell receptors. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. Within the variable domain, there are regions of even more variability called the hypervariable or complementarity-determining regions (CDRs) which are responsible for antigen binding. A predominant feature of most Ig domains is the disulfide bridge connecting 2 beta-sheets with a tryptophan residue packed against the disulfide bond.


Pssm-ID: 319275  Cd Length: 103  Bit Score: 84.37  E-value: 9.79e-23
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1KJ2_A       10 LTVWEGETAILNCSYEDSTFNY-FPWYQQFPGEGPALLISIRSVSDKKEDGRFTIFFNKREKKLSLHITDSQPGDSATYF 88
Cdd:cd00099   1 VSVSTGESVTLNCVLSGSFSLYsISWYRQKPGKQPQFLISGSSTGKPGIPGRFSGTRNGGSSSFSLTISNLRPEDSGTYY 80
                        90       100
                ....*....|....*....|...
1KJ2_A       89 CAAR--YQGGRALIFGTGTTVSV 109
Cdd:cd00099  81 CAVSegPGGGDKLVFGAGTRLTV 103
V-set pfam07686
Immunoglobulin V-set domain. This domain is found in antibodies as well as neural protein P0 ...
5-109 6.97e-21

Immunoglobulin V-set domain. This domain is found in antibodies as well as neural protein P0 and CTL4 amongst others.


Pssm-ID: 369466  Cd Length: 109  Bit Score: 80.20  E-value: 6.97e-21
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1KJ2_A          5 QSPQSLTVWEGETAILNCSY---EDSTFNYFPWYQQFPGEGPALLISIRSVSDK--KEDGRFTIFFNKREKKLSLHITDS 79
Cdd:pfam07686   1 QTPREVTVALGGSVTLPCTFsssMSSGSLSVYWYRQPPGKGPEFLIAYYSNGSNegKKKGRFSLRGDPSNSDGSLTIQNL 80
                          90       100       110
                  ....*....|....*....|....*....|
1KJ2_A         80 QPGDSATYFCAARYQGgrALIFGTGTTVSV 109
Cdd:pfam07686  81 TPSDSGTYTCAVIPNG--IVVFGKGTRLTV 108
IgV_TCR_delta cd07706
Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) delta chain. IgV_TCR_delta: ...
2-111 9.66e-21

Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) delta chain. IgV_TCR_delta: immunoglobulin (Ig) variable (V) domain of the delta chain of gamma/delta T-cell receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are heterodimers consisting of alpha and beta chains or gamma and delta chains. Each chain contains a variable (V) and a constant (C) region. The majority of T cells contain alpha/beta TCRs but a small subset contain gamma/delta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. Gamma/delta TCRs recognize intact protein antigens; they recognize protein antigens directly and without antigen processing, and MHC independently of the bound peptide. Gamma/delta T cells can also be stimulated by non-peptide antigens such as small phosphate- or amine-containing compounds. The variable domain of gamma/delta TCRs is responsible for antigen recognition and is located at the N-terminus of the receptor.


Pssm-ID: 319330  Cd Length: 112  Bit Score: 79.85  E-value: 9.66e-21
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1KJ2_A        2 QVRQSPQSLTVWEGETAILNCSYEDSTFNYFP-WYQQFPGEGPALLISIRSVSDKKEDGRFTIFFNKREKKLSLHITDSQ 80
Cdd:cd07706   1 KVTQAQPDVSVQVGEEVTLNCRYETSWTNYYLfWYKQLPSGEMTFLIRQDSSRSNATSGRYSVNFQKAQKSISLTISALQ 80
                        90       100       110
                ....*....|....*....|....*....|..
1KJ2_A       81 PGDSATYFCAARYQGGR-ALIFGTGTTVSVSP 111
Cdd:cd07706  81 LEDSAKYFCALSLPYPTdKLIFGKGTRLTVEP 112
IgV_TCR_beta cd05899
Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain. IgV_TCR_beta: ...
3-109 7.75e-20

Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain. IgV_TCR_beta: immunoglobulin (Ig) variable domain of the beta chain of alpha/beta T-cell antigen receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are composed of alpha and beta, or gamma and delta, polypeptide chains with variable (V) and constant (C) regions. This group includes the variable domain of the alpha chain of alpha/beta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. The variable domain of TCRs is responsible for antigen recognition, and is located at the N-terminus of the receptor. Gamma/delta TCRs recognize intact protein antigens; they recognize proteins antigens directly and without antigen processing, and MHC independently of the bound peptide.


Pssm-ID: 143307  Cd Length: 110  Bit Score: 77.33  E-value: 7.75e-20
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1KJ2_A        3 VRQSPQSLTVWEGETAILNCSYEDSTFNYFpWYQQFPGEGPALLISIRSVSDKKEDGRFTI-FFNKREKK--LSLHITDS 79
Cdd:cd05899   1 VTQSPRYLIKGRGQSVTLRCSQTSGHDNMY-WYRQDPGKGLQLLFYSNGGSLNEEEGDPKDrFSASRPSLtrSSLTIKSA 79
                        90       100       110
                ....*....|....*....|....*....|.
1KJ2_A       80 QPGDSATYFCAARYQGGRA-LIFGTGTTVSV 109
Cdd:cd05899  80 EPEDSAVYLCASSLGGGADeAYFGPGTRLTV 110
IG smart00409
Immunoglobulin;
7-109 1.50e-14

Immunoglobulin;


Pssm-ID: 214652  Cd Length: 85  Bit Score: 63.29  E-value: 1.50e-14
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1KJ2_A           7 PQSLTVWEGETAILNCSYEDSTFNYFPWYQQfpgeGPALLIsirsvsdkkEDGRFTIFFNKRekKLSLHITDSQPGDSAT 86
Cdd:smart00409   1 PPSVTVKEGESVTLSCEASGSPPPEVTWYKQ----GGKLLA---------ESGRFSVSRSGS--TSTLTISNVTPEDSGT 65
                           90       100
                   ....*....|....*....|...
1KJ2_A          87 YFCAARYQGGraLIFGtGTTVSV 109
Cdd:smart00409  66 YTCAATNSSG--SASS-GTTLTV 85
IG_like smart00410
Immunoglobulin like; IG domains that cannot be classified into one of IGv1, IGc1, IGc2, IG.
7-109 1.50e-14

Immunoglobulin like; IG domains that cannot be classified into one of IGv1, IGc1, IGc2, IG.


Pssm-ID: 214653  Cd Length: 85  Bit Score: 63.29  E-value: 1.50e-14
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1KJ2_A           7 PQSLTVWEGETAILNCSYEDSTFNYFPWYQQfpgeGPALLIsirsvsdkkEDGRFTIFFNKRekKLSLHITDSQPGDSAT 86
Cdd:smart00410   1 PPSVTVKEGESVTLSCEASGSPPPEVTWYKQ----GGKLLA---------ESGRFSVSRSGS--TSTLTISNVTPEDSGT 65
                           90       100
                   ....*....|....*....|...
1KJ2_A          87 YFCAARYQGGraLIFGtGTTVSV 109
Cdd:smart00410  66 YTCAATNSSG--SASS-GTTLTV 85
IgV_TCR_gamma cd04982
Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) gamma chain. IgV_TCR_gamma: ...
5-109 3.59e-14

Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) gamma chain. IgV_TCR_gamma: immunoglobulin (Ig) variable (V) domain of the gamma chain of gamma/delta T-cell receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are heterodimers consisting of alpha and beta chains or gamma and delta chains. Each chain contains a variable (V) and a constant (C) region. The majority of T cells contain alpha/beta TCRs but a small subset contain gamma/delta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. Gamma/delta TCRs recognize intact protein antigens; they recognize protein antigens directly and without antigen processing, and MHC independently of the bound peptide. Gamma/delta T cells can also be stimulated by non-peptide antigens such as small phosphate- or amine-containing compounds. The variable domain of gamma/delta TCRs is responsible for antigen recognition and is located at the N-terminus of the receptor.


Pssm-ID: 143183  Cd Length: 116  Bit Score: 63.15  E-value: 3.59e-14
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1KJ2_A        5 QSPQSLTVWEGETAILNCSYEDSTFN--YFPWYQQFPGEGPALLISIRSVSDKKED-----GRFTIFFNKREKKLSLHIT 77
Cdd:cd04982   3 QPQLSITREESKSVTISCKVSGIDFSttYIHWYRQKPGQALERLLYVSSTSTQRKLsggtkNKFEARKDVGKSTSTLTIQ 82
                        90       100       110
                ....*....|....*....|....*....|....
1KJ2_A       78 DSQPGDSATYFCAA--RYQGGRALIFGTGTTVSV 109
Cdd:cd04982  83 NLEKEDSATYYCAYweSGSSYYIKVFGSGTKLIV 116
IGv smart00406
Immunoglobulin V-Type;
17-90 1.81e-13

Immunoglobulin V-Type;


Pssm-ID: 214650  Cd Length: 81  Bit Score: 60.47  E-value: 1.81e-13
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1KJ2_A          17 TAILNCSYEDSTF--NYFPWYQQFPGEGPALLISIRS----VSDKKEDGRFTIFFNKREKKLSLHITDSQPGDSATYFCA 90
Cdd:smart00406   1 SVTLSCKFSGSTFssYYVSWVRQPPGKGLEWLGYIGSngssYYQESYKGRFTISKDTSKNDVSLTISNLRVEDTGTYYCA 80
IgV_L_kappa cd04980
Immunoglobulin (Ig) light chain, kappa type, variable (V) domain. IgV_L_kappa: Immunoglobulin ...
2-109 5.14e-13

Immunoglobulin (Ig) light chain, kappa type, variable (V) domain. IgV_L_kappa: Immunoglobulin (Ig) light chain, kappa type, variable (V) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin: IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which seem to be functionally identical, and can associate with any of the heavy chains.


Pssm-ID: 143181  Cd Length: 106  Bit Score: 59.80  E-value: 5.14e-13
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1KJ2_A        2 QVRQSPQSLTVWEGETAILNC-SYEDSTFNYFPWYQQFPGEGPALLISIRSVSDKKEDGRF------TIFfnkrekklSL 74
Cdd:cd04980   2 VLTQSPATLSVSPGESATISCkASQSVSSNYLAWYQQKPGQAPKLLIYGASTLASGTPSRFsgsgsgTDF--------TL 73
                        90       100       110
                ....*....|....*....|....*....|....*.
1KJ2_A       75 HITDSQPGDSATYFCAaryQGGR-ALIFGTGTTVSV 109
Cdd:cd04980  74 TISRVEPEDAAVYYCQ---QYGTfPYTFGGGTKLEI 106
IgV_L_lambda cd04984
Immunoglobulin (Ig) lambda light chain variable (V) domain. IgV_L_lambda: Immunoglobulin (Ig) ...
10-109 5.49e-11

Immunoglobulin (Ig) lambda light chain variable (V) domain. IgV_L_lambda: Immunoglobulin (Ig) light chain, lambda type, variable (V) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin: IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which seem to be functionally identical, and can associate with any of the heavy chains.


Pssm-ID: 143185  Cd Length: 98  Bit Score: 54.37  E-value: 5.49e-11
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1KJ2_A       10 LTVWEGETAILNCSYEDSTF--NYFPWYQQFPGEGPALLISIRSvsdKKEDG---RFTifFNKREKKLSLHITDSQPGDS 84
Cdd:cd04984   1 LSVSPGETVTITCTGSSGNIsgNYVNWYQQKPGSAPRYLIYEDS---DRPSGipdRFS--GSKSGNTASLTISGAQTEDE 75
                        90       100
                ....*....|....*....|....*
1KJ2_A       85 ATYFCAARYqgGRALIFGTGTTVSV 109
Cdd:cd04984  76 ADYYCQVWD--SNSYVFGGGTKLTV 98
IgV_H_TCR_mu cd16095
T-cell receptor Mu, Heavy chain, variable (V) domain. IgV_H: Immunoglobulin (Ig) heavy chain ...
15-109 7.87e-11

T-cell receptor Mu, Heavy chain, variable (V) domain. IgV_H: Immunoglobulin (Ig) heavy chain (H), variable (V) domain in mu. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin: IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which can associate with any of the heavy chains. This family includes alpha, gamma, delta, epsilon, and mu heavy chains.


Pssm-ID: 319344  Cd Length: 112  Bit Score: 54.48  E-value: 7.87e-11
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1KJ2_A       15 GETAILNCSYEDSTFN--YFPWYQQFPGEGPALLISIRSVSDKKEDGRFTIFFNKREKKLSLHITDSQPGDSATYFCAAR 92
Cdd:cd16095  12 GKTLSLKCQTSGFQFNtsQLSWYLWVPGHAPLWLTSLDHISTKASEDRITSSREDTNSQIFLQIKGLGLRDSGQYHCARR 91
                        90       100
                ....*....|....*....|
1KJ2_A       93 YQGG---RALIFGTGTTVSV 109
Cdd:cd16095  92 VGYGddtDKLIFGPGTDVIV 111
IgV_H cd04981
Immunoglobulin (Ig) heavy chain (H), variable (V) domain. IgV_H: Immunoglobulin (Ig) heavy ...
11-110 4.73e-08

Immunoglobulin (Ig) heavy chain (H), variable (V) domain. IgV_H: Immunoglobulin (Ig) heavy chain (H), variable (V) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin: IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which can associate with any of the heavy chains. This family includes alpha, gamma, delta, epsilon, and mu heavy chains.


Pssm-ID: 319286  Cd Length: 117  Bit Score: 47.33  E-value: 4.73e-08
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1KJ2_A       11 TVWEGETAILNCSYEDSTFN--YFPWYQQFPGEGPALLISIRSVSDK-----KEDGRFTIFFNKREKKLSLHITDSQPGD 83
Cdd:cd04981   8 LVKPGQSLSLSCKASGFTFTsyGVGWVRQAPGKGLEWIGGIYPGGGEtyyadSVKGRFTITRDTSKSTVYLQLNSLTPED 87
                        90       100       110
                ....*....|....*....|....*....|
1KJ2_A       84 SATYFCAARYQGGRALIF---GTGTTVSVS 110
Cdd:cd04981  88 TAVYYCARGLGGYGYGYFdywGQGTLVTVS 117
IgV_PD1 cd16088
Immunoglobulin (Ig)-like domain of Programmed cell Death 1 (PD1). Programmed cell Death 1 ...
6-100 7.38e-08

Immunoglobulin (Ig)-like domain of Programmed cell Death 1 (PD1). Programmed cell Death 1 (PD1, also known as CD279 or cluster of differentiation 279) is a cell surface receptor that is expressed on T cells and pro-B cells. The protein's structure includes an extracellular IgV domain followed by a transmembrane region and an intracellular tail. Activation of CD4+ T cells, CD8+ T cells, NKT cells, B cells, and monocytes induces PD-1 expression, immediately after which it binds two distinct ligands, PD-L1 (also known as B7-H1 or CD274) and PD-L2, also known as B7-DC. PD-1 plays an important role in down regulating the immune system by preventing the activation of T-cells, reducing autoimmunity and promoting self-tolerance. The inhibitory effect of PD-1 is accomplished by promoting apoptosis in antigen specific T-cells in lymph nodes while simultaneously reducing apoptosis in regulatory T cells. A class of drugs that target PD-1, known as the PD-1 inhibitors, activate the immune system to attack tumors and treat cancer. Comparisons between the mouse PD-1 (mPD-1) and human PD-1 (hPD-1) reveals that unlike the mPD-1 which has a conventional IgSF V-set domain, hPD-1 lacks a C" strand, and instead the C' and D strands are connected by a long and flexible loop. In addition, the BC loop is not stabilized by disulfide bonding to the F strand of the ligand binding beta sheet. These differences result in different binding affinities of human and mouse PD-1 for their ligands.


Pssm-ID: 319337  Cd Length: 110  Bit Score: 46.43  E-value: 7.38e-08
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1KJ2_A        6 SPQSLTVWEGETAILNCSY-EDSTFNYFPWYQQFPGEGPALLISI-RSVSDKKEDGRFTIFFNKREKKLSLHITDSQPGD 83
Cdd:cd16088   4 SPAWLSVTEGANATFTCSLsNWSEDLMLNWYRLSPSNQTEKLAAFpEDQSQPGQDWRFRVTQLPNGHDFHMNLLDARRND 83
                        90
                ....*....|....*..
1KJ2_A       84 SATYFCAARYQGGRALI 100
Cdd:cd16088  84 SGTYLCGAISLHPKAHI 100
ig pfam00047
Immunoglobulin domain. Members of the immunoglobulin superfamily are found in hundreds of ...
5-96 4.51e-06

Immunoglobulin domain. Members of the immunoglobulin superfamily are found in hundreds of proteins of different functions. Examples include antibodies, the giant muscle kinase titin and receptor tyrosine kinases. Immunoglobulin-like domains may be involved in protein-protein and protein-ligand interactions.


Pssm-ID: 365836  Cd Length: 86  Bit Score: 41.40  E-value: 4.51e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1KJ2_A          5 QSPQSLTVWEGETAILNCSY-EDSTFNYFPWYQqfpgEGPALLISIRSVSDkkedgrftiffNKREKKLSLHITDSQPGD 83
Cdd:pfam00047   1 SAPPTVTVLEGESATLTCSAsTGSPLPDVTWSK----EGGTLIESLRVKHD-----------NGRTTQSSLLISNVTLED 65
                          90
                  ....*....|...
1KJ2_A         84 SATYFCAARYQGG 96
Cdd:pfam00047  66 AGTYTCVVNNPGG 78
IgV_CD8_beta cd07700
Immunoglobulin (Ig) like domain of CD8 beta chain. IgV_CD8_beta: immunoglobulin (Ig)-like ...
60-109 5.57e-06

Immunoglobulin (Ig) like domain of CD8 beta chain. IgV_CD8_beta: immunoglobulin (Ig)-like domain in CD8 beta. The CD8 glycoprotein plays an essential role in the control of T-cell selection, maturation and the T-cell receptor (TCR)-mediated response to peptide antigen. CD8 is comprised of alpha and beta subunits and is expressed as either an alpha/alpha or alpha/beta dimer. Both dimeric isoforms can serve as a coreceptor for T cell activation and differentiation, however they have distinct physiological roles, different cellular distributions, unique binding partners etc. Each CD8 subunit is comprised of an extracellular domain containing a V-type Ig-like domain, a single pass transmembrane portion and a short intracellular domain.


Pssm-ID: 319326  Cd Length: 108  Bit Score: 41.66  E-value: 5.57e-06
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|
1KJ2_A       60 RFTIFFNKREKKLSLHITDSQPGDSATYFCAAryQGGRALIFGTGTTVSV 109
Cdd:cd07700  61 KNIILSSSDSSRYILSLMSVKPEDSGTYFCMT--VGSPELIFGTGTKLSV 108
IgV_SIRP cd16097
Immunoglobulin (Ig)-like domain of Signal-Regulatory Protein (SIRP). IgV: immunoglobulin (Ig) ...
2-109 1.25e-05

Immunoglobulin (Ig)-like domain of Signal-Regulatory Protein (SIRP). IgV: immunoglobulin (Ig)-like domain in Signal-Regulatory Protein (SIRP). The SIRPs belong to the "paired receptors" class of membrane proteins that comprise several genes coding for proteins with similar extracellular regions but very different transmembrane/cytoplasmic regions with different (activating or inhibitory) signaling potentials. They are commonly on NK cells, but are also on many myeloid cells. Their extracellular region contains three Immunoglobulin superfamily domains a single V-set and two C1-set IgSF domains. Their cytoplasmic tails that contain either ITIMs or transmembrane regions that have positively charged residues that allow an association with adaptor proteins, such as DAP12/KARAP, containing ITAMs. There are 3 distinct SIRP members: alpha, beta, and gamma. SIRP alpha (also known as CD172a or SRC homology 2 domain-containing protein tyrosine phosphatase substrate 1/Shps-1) is a membrane receptor that interacts with a ligand CD47 expressed on many cells and gives an inhibitory signal through immunoreceptor tyrosine-based inhibition motifs in the cytoplasmic region that interact with phosphatases SHP-1 and SHP-2. SIRP beta has a short cytoplasmic region and associates with a transmembrane adapter protein DAP12 containing immunoreceptor tyrosine-based activation motifs to give an activating signal. SIRP gamma contains a very short cytoplasmic region lacking obvious signaling motifs but also binds CD47, but with much less affinity.


Pssm-ID: 319346  Cd Length: 111  Bit Score: 40.61  E-value: 1.25e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1KJ2_A        2 QVRQSPQSLTVWEGETAILNCSYEdSTFNYFPwYQQFPGEGPAllisiRSVSDKKEDGRFTIFFN-----KREK-KLSLH 75
Cdd:cd16097   1 QVIQPEKSVSVAAGESATLHCTVT-SLIPVGP-IQWFRGAGPG-----RELIYNQKEGHFPRVTTvsdltKRNNmDFSIR 73
                        90       100       110
                ....*....|....*....|....*....|....*...
1KJ2_A       76 ITDSQPGDSATYFCaARYQGGRA----LIFGTGTTVSV 109
Cdd:cd16097  74 ISNITPADAGTYYC-VKFRKGSPddveFKSGAGTELSV 110
Ig_Siglec_N cd05712
Immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins). ...
5-101 7.69e-05

Immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins). Ig_Siglec_N: immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins). Siglec refers to a structurally related protein family that specifically recognizes sialic acid in oligosaccharide chains of glycoproteins and glycolipids. Siglecs are type I transmembrane proteins, organized as an extracellular module composed of Ig-like domains (an N-terminal variable set of Ig-like carbohydrate recognition domains, and 1 to 16 constant Ig-like domains), followed by transmembrane and short cytoplasmic domains. Human siglecs are classified into two subgroups, one subgroup is comprised of sialoadhesin (Siglec-1), CD22 (Siglec-2), and MAG, the other subgroup is comprised of CD33-related Siglecs which include CD33 (Siglec-3) and human Siglecs 5-11.


Pssm-ID: 143189  Cd Length: 119  Bit Score: 38.94  E-value: 7.69e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1KJ2_A        5 QSPQSLTVWEGETAILNCS------YEDSTFNYFPWYQQFPGEG---PALLISIRSVSDKKEDGRFTIFFNKREKKLSLH 75
Cdd:cd05712   4 WMPKSVSVQEGLCVLIPCSfsypadWPVSNGVHGIWYKGHPYPKnrpPVATNNRSRLVHESTRGRFRLLGDLGKKNCSLL 83
                        90       100
                ....*....|....*....|....*.
1KJ2_A       76 ITDSQPGDSATYFcaARYQGGRALIF 101
Cdd:cd05712  84 ISDAQPEDSGKYF--FRVELGDSNKY 107
I-set pfam07679
Immunoglobulin I-set domain.
5-98 4.72e-03

Immunoglobulin I-set domain.


Pssm-ID: 369462  Cd Length: 90  Bit Score: 33.39  E-value: 4.72e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1KJ2_A          5 QSPQSLTVWEGETAILNCsyedstfnyfpwyqQFPGEgPALLIS-IRSVSDKKEDGRFTIFFNkrEKKLSLHITDSQPGD 83
Cdd:pfam07679   5 QKPKDVEVQEGESARFTC--------------TVTGT-PDPEVSwFKDGQPLRSSDRFKVTYE--GGTYTLTISNVQPDD 67
                          90
                  ....*....|....*
1KJ2_A         84 SATYFCAARYQGGRA 98
Cdd:pfam07679  68 SGKYTCVATNSAGEA 82
Ig_3 pfam13927
Immunoglobulin domain. This family contains immunoglobulin-like domains.
2-92 7.73e-03

Immunoglobulin domain. This family contains immunoglobulin-like domains.


Pssm-ID: 372822  Cd Length: 77  Bit Score: 32.89  E-value: 7.73e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1KJ2_A          2 QVRQSPQSlTVWEGETAILNCSYEDSTFNYFPWYqqFPGEgpallisirsvsdKKEDGRFTIFFNKREKKLSLHITDSQP 81
Cdd:pfam13927   2 VITVSPSS-VVVEGESVTLTCEATGGPPPTITWY--KNGE-------------PISSGRTSDRISLSGSSSTLTISNVTR 65
                          90
                  ....*....|.
1KJ2_A         82 GDSATYFCAAR 92
Cdd:pfam13927  66 EDSGTYTCVAS 76
Ig1_Necl_like cd05717
First (N-terminal) immunoglobulin (Ig)-like domain of the nectin-like molecules. ...
8-89 8.87e-03

First (N-terminal) immunoglobulin (Ig)-like domain of the nectin-like molecules. Ig1_Necl_like: N-terminal immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 (also known as cell adhesion molecule 3 (CADM3)), Necl-2 (CADM1), Necl-3 (CADM2), and similar proteins. At least five nectin-like molecules have been identified (Necl-1 to Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-1, Necl-2, and Necl-3 have Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is specifically expressed in neural tissue, and is important to the formation of synapses, axon bundles, and myelinated axons. Necl-2 is expressed in a wide variety of tissues, and is a putative tumour suppressor gene, which is downregulated in aggressive neuroblastoma. Necl-3 accumulates in central and peripheral nervous system tissue, and has been shown to selectively interact with oligodendrocytes. This group also contains Class-I MHC-restricted T-cell-associated molecule (CRTAM), whose expression pattern is consistent with its expression in Class-I MHC-restricted T-cells.


Pssm-ID: 319294  Cd Length: 95  Bit Score: 32.87  E-value: 8.87e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1KJ2_A        8 QSLTVWEGETAILNCSYEDSTFNYFPWY---QQ--FPGEGPALlisirsvsdkkEDGRFTIfFNKREKKLSLHITDSQPG 82
Cdd:cd05717   5 QDVTVVEGETLTLKCQVRNADNSSLQWLnpnGQtiYFNDKKAL-----------RDSRYQL-LNLSESELSISVSNVTLS 72

                ....*..
1KJ2_A       83 DSATYFC 89
Cdd:cd05717  73 DEGLYTC 79
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH